KEGG   Lactobacillus casei LOCK919: LOCK919_1633Help
Entry
LOCK919_1633      CDS       T02729                                 

Definition
(GenBank) Ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
lcl  Lactobacillus casei LOCK919
Brite
KEGG Orthology (KO) [BR:lcl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:lcl03009]
    LOCK919_1633
Enzymes [BR:lcl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     LOCK919_1633
Ribosome biogenesis [BR:lcl03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    LOCK919_1633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 S4_2 Ub-Mut7C
Motif
Other DBs
NCBI-ProteinID: AGP68330
UniProt: K6QFH1
Position
complement(1601592..1602512)
Genome map
AA seq 306 aa AA seqDB search
MTSTFTITTEQGRIDKVITAHETTHTRSQVQKWLQDGLVTVNGQPTKANYKVASGDVIAI
SIPEAKPLEAIPEPIPLDIVYEDDQVIVVDKPQGMVVHPAPGHPDGTLVNGLLYHTDLPG
INGVIRPGIVHRIDKDTSGLLMVAKTEKAQLSLSAQLKAKTSIREYLALVHGTFKEDEGT
IDAPLGRDPRDRKRQAVVADGRHAVTHFQVLERFEHYTFIKCILETGRTHQIRVHMAYIH
HPVAGDPLYGPKRTLPGKGQFLHAAKLGFVHPTTGQLLVFEAPVPPIFEKTLADLRAGID
KTRNVR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgactagcacctttacgatcacgaccgagcaggggcgcatcgataaggttatcacggcg
catgaaaccactcacacgcgcagtcaggtgcaaaaatggttgcaagatggcttggtgacg
gtcaatgggcagccaaccaaggccaattacaaagttgctagcggcgatgtgattgctatc
tcaattcctgaagccaagccgctggaagctattccggagccgatcccgctcgatattgtg
tatgaagacgaccaagtcattgtcgtcgacaaaccgcagggcatggtggtacatcctgca
cctggtcatccagatggcacactggtcaacggtttgttatatcatactgatttgccgggc
atcaacggtgtcattcgtcccggcatcgtgcatcgcatcgacaaggacaccagcggacta
ctgatggttgctaaaaccgaaaaagcgcaactaagtctttccgcacaattaaaagccaaa
acatcgattcgtgagtatttagcacttgtccatggcacgttcaaagaagatgaaggcaca
attgatgcaccattgggtcgtgatccccgcgatcgtaaacgtcaagctgtcgtggcagac
ggtcgccatgctgttacccattttcaagtattagagcgttttgaacattacacgttcatt
aaatgcattttagagaccggccgcacgcatcaaattcgcgtgcacatggcatacattcat
caccctgtggccggggatccactttacgggccaaaacgcaccctgcccggcaaaggccaa
tttttgcacgcggctaaactgggattcgttcatccgacaaccggtcaattgctcgtcttc
gaagcaccagtaccgccaatttttgaaaaaaccttagccgatctacgtgcaggcattgac
aagacccgcaacgttcggtaa

DBGET integrated database retrieval system