KEGG   Lactobacillus casei LOCK919: LOCK919_1807Help
Entry
LOCK919_1807      CDS       T02729                                 

Definition
(GenBank) Geranyltranstransferase
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
lcl  Lactobacillus casei LOCK919
Pathway
lcl00900  Terpenoid backbone biosynthesis
lcl01100  Metabolic pathways
lcl01110  Biosynthesis of secondary metabolites
lcl01130  Biosynthesis of antibiotics
Module
lcl_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:lcl00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LOCK919_1807
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:lcl01006]
    LOCK919_1807
Enzymes [BR:lcl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     LOCK919_1807
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     LOCK919_1807
    2.5.1.29  geranylgeranyl diphosphate synthase
     LOCK919_1807
Prenyltransferases [BR:lcl01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   LOCK919_1807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt DUF1843
Motif
Other DBs
NCBI-ProteinID: AGP68502
UniProt: S4ZU77
Position
complement(1774810..1775661)
Genome map
AA seq 283 aa AA seqDB search
MSPMLAGWRTAVEQTLDEQLAAVANPHLRAAMVYSVEAGGKRLRPLLLLSVVAMYDGVIA
DALPAAAALEYVHTYSLIHDDLPAMDDDDLRRGKPTNHKQFGEALAILAGDALLTDAFAI
LSRQYPEKGAACVQILAEAAGSNGMVGGQVLDMDGENEQYHLETLKRMHEAKTGALIQAA
IAMGGLLVTIPETDQTALADFSAAFGLGFQIKDDINDVTKTTAELGKTADKDVIEHKNTF
PELLGLDGAIQALQVEIAKAETALNELTVDAAPLAEILAVLKA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgagccctatgttagcaggatggcgcacagccgttgaacagacgttggacgagcaatta
gctgctgttgctaacccgcatttgcgagcggcaatggtttattccgtggaggcaggtggc
aagcgcctgcgaccattgttgttgttgagtgtcgtggcgatgtatgacggtgtgattgct
gatgcattgccggctgctgctgctttggaatatgtgcatacttattcattgattcacgat
gatctgccggcgatggacgacgatgatctgcgtcgtgggaagccgaccaatcataagcag
tttggcgaagccttagcgattttggctggcgatgccttgctgaccgatgcgtttgctatt
ttaagccgccagtaccctgaaaaaggcgccgcatgtgtgcagattctagccgaagccgct
ggcagcaatggtatggttggtggccaagtgctcgatatggacggtgaaaacgagcaatac
catctcgaaactttgaaacgcatgcatgaagctaagactggcgccttgatccaagccgca
atcgcgatgggcgggctgcttgtgaccattccggagactgaccaaacagcactggctgat
ttttcggccgcttttggcttgggatttcaaattaaagatgatattaacgatgtgaccaaa
acaacggctgaactcgggaaaacggctgataaagatgtaattgagcataagaacactttt
cccgagttattggggttggacggtgctatccaagctttgcaggtagaaattgcaaaagca
gagacggcgttaaatgaattgacagttgacgcggcgccattggctgagattttggcggtg
ttgaaagcatga

DBGET integrated database retrieval system