KEGG   Lactobacillus casei LOCK919: LOCK919_1900Help
Entry
LOCK919_1900      CDS       T02729                                 

Definition
(GenBank) Arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
lcl  Lactobacillus casei LOCK919
Pathway
lcl00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:lcl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LOCK919_1900
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lcl01007]
    LOCK919_1900
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lcl03016]
    LOCK919_1900
   03029 Mitochondrial biogenesis [BR:lcl03029]
    LOCK919_1900
Enzymes [BR:lcl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     LOCK919_1900
Amino acid related enzymes [BR:lcl01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   LOCK919_1900
Transfer RNA biogenesis [BR:lcl03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    LOCK919_1900
 Prokaryotic Type
   Other AARSs
    LOCK919_1900
Mitochondrial biogenesis [BR:lcl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    LOCK919_1900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N
Motif
Other DBs
NCBI-ProteinID: AGP68594
UniProt: A0A1V0Q2J1
Position
complement(1861007..1862689)
Genome map
AA seq 560 aa AA seqDB search
MDFKELVVKALEPALAGQLDAAAIKSLIETPKSSDLGDYAFPTFSLAKIMHRAPKMIASD
LVGQIDVTPFEQVKAVGGYVNFYLDKISFAHDVLKVIAQAGEHYGDANIGSGNVPIDMSS
PNIAKPMSMGHLRSTVIGNALANILSKIGYTPIKINHLGDWGTQFGKLIVAYKKWGSEDA
VKADPIKNLLHYYVEFHEKAEANPELDDEARAWFKRLEDGDEEAIALWRWFRTVSLAEFN
RIYKILGVDFDSYNGEAFYNDKMADVVKRLEDKHLLKTSQGAEIVDLSAYNLNPALIKKS
DGATLYMTRDLAAAIFRKEHYHFVQSLYVVGNEQREHFQQLKAVLLEMGYDWANDIHHIP
FGLITANGKKLSTRKGNIILLENVLRDAVGLAKQQIAEKHPDLPNADKVAHEVGVGAVIF
HDLKNERLDNFDFNLEEVVRFEGETGPYVQYTNARANSILRKAAIDPAPEVALSDPAAWD
VLRALGDYPSMVLRAAKEYEPSVIAKYALRLAKAFNKYYANVKVLVEDSELPARLAMVKA
TTQVLTNALQLLGVGAPEEM
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggattttaaagaacttgttgttaaggcacttgaaccagcacttgccggtcaattagac
gcggctgcgatcaagtccttgattgaaacacccaagtcatcagacttaggagattatgct
tttccaaccttttccttggcgaagatcatgcatcgcgcaccaaagatgattgcgagcgat
ttggtcggtcaaattgatgtgaccccgtttgaacaagtgaaggctgttggtggctatgtt
aacttttatctggataaaatcagttttgcccacgatgtgttgaaagtgatcgcacaagct
ggcgagcattatggtgatgctaatatcggcagcgggaatgtaccgatcgacatgagcagc
ccgaacattgctaaaccaatgtccatggggcacttacgctcaaccgtgattggcaatgcc
ttagccaacattctcagcaaaatcgggtatacaccgattaaaattaatcaccttggcgac
tggggcacacaatttggtaaactgattgtggcgtacaagaagtggggatccgaggacgct
gtcaaagccgatccgatcaaaaatctattgcattactatgtggaatttcatgagaaggcc
gaggcaaatcccgagttggacgatgaggcccgtgcttggtttaagcggctggaagatggc
gatgaagaagccattgcgctttggcgctggttccgcacagtttcactagctgagttcaat
cgaatttacaaaattctcggtgttgactttgattcttacaatggcgaagccttttataat
gacaaaatggctgatgtggtgaagcgacttgaagacaagcatttgctgaaaactagtcaa
ggtgccgaaattgtggatttgagtgcgtataacttgaatccagcgctgatcaagaagtca
gatggcgcaacgctgtatatgacgcgtgatctcgctgctgcaattttccggaaagaacat
tatcattttgttcaaagcctgtacgttgttggtaatgaacaacgcgaacacttccagcag
ttaaaagccgtcttgttagaaatgggttacgactgggcgaatgatattcaccacattcca
tttgggctgattacggcgaatggcaagaagttgtcaacgcgtaaaggcaacatcatctta
ctggaaaatgttttgcgcgatgctgtcggtctggcgaaacaacaaattgctgaaaagcat
cccgatttaccaaatgcggataaagttgcgcatgaagtcggtgtcggcgccgtcattttc
catgacttgaagaacgaacgcttagacaacttcgacttcaacttagaagaagtcgtgcgt
tttgaaggtgaaactggtccatatgtacagtacacgaacgcgcgggctaatagcattttg
cggaaggctgcgattgacccggcgcctgaagtggctttaagtgatccagcggcttgggac
gttttgcgcgcccttggcgattatccaagcatggtcttgcgtgcagccaaggaatatgaa
ccttctgtgattgctaagtatgcactacgcttggcaaaagctttcaataagtattatgcc
aatgtcaaagtgctggttgaggacagtgagctgccagctcgattggcgatggttaaggcg
acgacacaagtgctaacaaatgcgctgcaactgttgggtgtcggtgcgccagaagaaatg
taa

DBGET integrated database retrieval system