KEGG   Lactobacillus casei LOCK919: LOCK919_1959Help
Entry
LOCK919_1959      CDS       T02729                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase / Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lcl  Lactobacillus casei LOCK919
Pathway
lcl00071  Fatty acid degradation
lcl00072  Synthesis and degradation of ketone bodies
lcl00280  Valine, leucine and isoleucine degradation
lcl00310  Lysine degradation
lcl00362  Benzoate degradation
lcl00380  Tryptophan metabolism
lcl00620  Pyruvate metabolism
lcl00630  Glyoxylate and dicarboxylate metabolism
lcl00640  Propanoate metabolism
lcl00650  Butanoate metabolism
lcl00900  Terpenoid backbone biosynthesis
lcl01100  Metabolic pathways
lcl01110  Biosynthesis of secondary metabolites
lcl01120  Microbial metabolism in diverse environments
lcl01130  Biosynthesis of antibiotics
lcl01200  Carbon metabolism
lcl01212  Fatty acid metabolism
lcl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lcl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LOCK919_1959
   00630 Glyoxylate and dicarboxylate metabolism
    LOCK919_1959
   00640 Propanoate metabolism
    LOCK919_1959
   00650 Butanoate metabolism
    LOCK919_1959
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LOCK919_1959
   00072 Synthesis and degradation of ketone bodies
    LOCK919_1959
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LOCK919_1959
   00310 Lysine degradation
    LOCK919_1959
   00380 Tryptophan metabolism
    LOCK919_1959
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LOCK919_1959
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LOCK919_1959
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LOCK919_1959
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lcl04147]
    LOCK919_1959
Enzymes [BR:lcl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LOCK919_1959
Exosome [BR:lcl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LOCK919_1959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGP68651
UniProt: S4ZMZ6
Position
complement(1920954..1922135)
Genome map
AA seq 393 aa AA seqDB search
MEEVVILSAKRTPIGKLGGDLAGASAVDLGVAAAQAAIKAARIDPALLNQAIFGNVMQAG
SGQNVARQIGLKSGMATSSTAMTVNEVCGSGLKAVRLGQAAIQLGEADAVLVGGTESMSQ
VPYYAEAVRSGHKFGDTTLVDGLSRDGLNDAFSQQPMGITAENVATQFNVSRQEQDEFAL
RSHLRAAAAAAEGRFKSQIAPVTIAARHGDVIVDRDSAIRPDTSLAKLAQLPPVFEVGGT
VTAGNASGINDGAAALILMAKSKAEQLGLHYLATITGFSEVGIDPAIMGYAPKLAIDKIL
QATGGSIAAIDQIELNEAFASQSVAVARDLGLKDEQFNINGGALALGHPLGASGARILIS
LLYDLGERNQRQGIAALCVGGGIGIAMQIAMHV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagttgtgattctaagtgccaaacggacgccgattggtaagttgggtggtgat
ttggctggcgccagtgccgttgatttaggggttgcggcagcgcaggcggcaattaaggct
gcacgaattgacccagcgttactcaatcaggcgatctttggtaatgtcatgcaggctggt
tctgggcagaatgttgcccgacaaatcggattaaaaagcggtatggccactagcagcacg
gcgatgactgtcaatgaagtctgcggctcaggcctgaaggcagtgcggcttgggcaagct
gccattcaactcggcgaggctgacgcggtgcttgtgggcggtaccgaaagcatgagtcaa
gtaccttattacgccgaagcggttcgttcaggccacaaatttggtgatacaacgctggtc
gacggtttgagtcgcgatggattaaatgatgccttcagtcagcagccaatgggaatcacg
gcggaaaatgtggcgacacaatttaacgtcagtcgtcaggagcaagatgagtttgctctc
cgttcgcatttacgcgccgcggccgccgcagctgagggtcggtttaagagtcagatcgcc
ccagtgacgattgctgcccgtcacggggatgtcatcgtagatcgtgattcagccattcgg
cccgatacgtcattggctaaattagcccaattaccgcctgtttttgaagtcggcgggact
gttacagcaggtaacgcaagcggcattaatgatggcgcagccgccttgatcctgatggca
aaatcgaaagccgaacaactggggctccattatttagcgacgatcactggtttttccgag
gtgggtattgatccggcaattatggggtatgcgccaaaactggcgatcgataaaatactg
caggcaaccggcggctctatcgcggcaattgatcaaattgaattgaatgaagcatttgcc
tcacaaagcgttgctgtggctcgtgaccttggtttaaaggatgaacaattcaatatcaat
ggtggcgccttagcgttgggtcatccattgggagcttcaggtgcccgaattttaatctca
ttattgtacgatctgggtgaacgtaatcaacgccaaggcattgccgcattgtgcgttggc
ggtggcatcggtatcgccatgcaaatcgcgatgcatgtctga

DBGET integrated database retrieval system