KEGG   Lactobacillus casei LOCK919: LOCK919_2033Help
Entry
LOCK919_2033      CDS       T02729                                 

Definition
(GenBank) Oxaloacetate decarboxylase alpha chain
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
lcl  Lactobacillus casei LOCK919
Pathway
lcl00620  Pyruvate metabolism
lcl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LOCK919_2033
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lcl02000]
    LOCK919_2033
Enzymes [BR:lcl01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     LOCK919_2033
Transporters [BR:lcl02000]
 Other transporters
  Primary active transporters [TC:3]
   LOCK919_2033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA 6PF2K
Motif
Other DBs
NCBI-ProteinID: AGP68715
UniProt: S4ZPX0
Position
complement(1991500..1992903)
Genome map
AA seq 467 aa AA seqDB search
MPKQKVQFMETVLRDGQQSLIATRMPLSDILPILDKMDAAGYASLEMWGGATFDACLRYL
NEDPWERLRKIRKAVKHTKLQMLLRGQNLLGYKNYADDVVTDFVTKSVENGIDIIRIFDA
LNDTRNLRTALEATRQAGGHAQLAICYTTSDFHTIDYFIKLAKDMADMGADSIAIKDMAG
ILTPQKAFDLVTGIKQEISVPLEVHTHATAGMAEMTYLEAVRAGADIIDTAVSPFAGGTS
QPATESMLVALQDLGYPTDVDLSTVSDIATYFAPIRDRFRESGQLNPRVKDVEPKSLIYQ
VPGGMLSNLLAQLKDQGQEALYGDVLKEVPRVRADLGYPPLVTPLSQMVGTQSLMNVMSG
ERYKLIPNEIKDYVRGLYGRPPVAIAPEMVKKIIGDAPVVTQRPADLIKPQMPDFRQAIA
QYAHDEEDVLSYALFPDQAKDFLGRREDPFYDVPEQKVSLSFEPTHD
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaacagaaagtccaattcatggaaaccgttttgcgtgacgggcaacaaagcctg
attgccacgcggatgccgctcagcgatattttgccgattctcgataaaatggatgctgct
ggctatgcatctttggaaatgtggggcggggcaacttttgatgcctgtctccgttatctg
aatgaagatccgtgggaacggttgcgcaagattcgtaaggcggtcaagcacaccaaattg
caaatgctcttgcgcgggcaaaacttgttaggttacaaaaactatgccgacgatgtggtc
actgactttgtcacaaagtcagttgaaaacgggattgatatcattcgtattttcgatgcg
ttgaatgatacacgcaacttgcgaacggcgcttgaagcgacgaggcaagcaggcgggcat
gctcaacttgctatttgttacacaaccagtgatttccatacgatcgactacttcatcaag
ttagccaaagacatggctgacatgggtgcggattcaattgcaatcaaagacatggcaggc
attttaaccccacagaaggcgtttgatctggttaccggtattaagcaggaaatcagcgtg
ccactggaagtgcatacgcacgccaccgctggtatggctgagatgacgtatctggaagca
gttcgcgccggtgctgatatcattgataccgcggtttcgccatttgctggcggcaccagt
cagccagcaacagaatccatgctggttgcgttgcaagatcttggctatccgactgatgtt
gatttaagcacggtcagtgacatcgccacttactttgcgccgattcgcgatcgattccgc
gagtccggtcaactgaatccgcgcgtgaaagatgttgaacctaaatccttgatctatcag
gtgccaggcgggatgttgtctaacctgttggcgcaactaaaagatcaaggacaagaagcg
ctttatggcgatgttttgaaggaagtgccgcgtgtccgagctgacttaggctatccgccg
ttggttacaccgctgtcgcagatggtgggcacacaaagtttgatgaatgtcatgagcggt
gagcgttataagttgattccaaatgaaattaaggattacgtgcgcggcctttatggtcgg
ccgccagtggcaattgcacccgaaatggtgaaaaagatcattggtgatgcaccggttgtc
acacaacgtcccgcggatttaatcaagccgcaaatgcctgatttccgtcaagcgattgcg
caatatgcgcacgacgaagaggatgtcttaagctatgctttgttcccagatcaagctaaa
gattttcttggccggcgcgaagatccgttttatgatgtgccggagcagaaggtgtcgcta
agttttgagccgacgcatgattga

DBGET integrated database retrieval system