KEGG   Lactobacillus casei LOCK919: LOCK919_2351Help
Entry
LOCK919_2351      CDS       T02729                                 

Definition
(GenBank) Glucose 1-dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
lcl  Lactobacillus casei LOCK919
Pathway
lcl00030  Pentose phosphate pathway
lcl01100  Metabolic pathways
lcl01120  Microbial metabolism in diverse environments
lcl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lcl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LOCK919_2351
Enzymes [BR:lcl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     LOCK919_2351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR THF_DHG_CYH_C
Motif
Other DBs
NCBI-ProteinID: AGP69033
UniProt: A0A0K1L158
Position
complement(2314734..2315519)
Genome map
AA seq 261 aa AA seqDB search
MYQDLNGKIAIVTGGSKGIGAAIAERFGKEHMSVVINYLGDHEGAKQVADTVIKNGGQAV
SIHADVSTEDGIASLVETATAHFGGLDVWVNNAGMEIKEPTHQVSLEDWNKVIAINQTGV
FLGARAALNYFLEHHQAGNIINITSVHEQIPWPTFASYAAAKGAVKLFTQTIAMEYAKQG
IRVNAIGPGAIETPINAEKFADKAQYDQTVSMVPMNRIGKPEDVSAGAAWLASSESSYVT
GITLFIDGGMTLYPAFKDGQG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaagacttgaacggaaagattgcaattgtgacgggtggttcaaaaggcatcggc
gctgccattgcagaacgatttggcaaagagcacatgtcagtcgtgatcaattatttaggt
gatcatgaaggtgcaaagcaagtcgccgacaccgtgatcaaaaacggcgggcaggcggtg
agcatccatgctgatgtttccacagaagatggcattgctagcttagttgagacagcaacg
gcgcattttggcggacttgatgtctgggtgaataacgctggcatggaaatcaaggaacca
acgcatcaagtctctttggaggactggaacaaagtcattgccattaatcaaaccggcgtc
tttttaggagcgcgggctgcactgaactattttcttgaacaccatcaggcaggcaacatt
attaatatcacctcggtgcatgaacaaattccgtggccaaccttcgcgagttatgcggcg
gccaaaggtgcagtcaaactttttacccagacgattgcgatggaatatgctaagcaaggg
atccgggtcaatgcgattggccctggtgcgattgaaacgccgattaacgccgagaaattt
gctgacaaggcgcagtatgaccagacagtttcaatggtaccgatgaatcgaattggcaaa
cctgaagatgtgtcagctggtgcagcatggctggcatccagcgaatccagttatgtgact
ggcattaccttattcattgatggcgggatgactttatatccggcatttaaagatggtcaa
ggttga

DBGET integrated database retrieval system