KEGG   Lactobacillus casei LOCK919: LOCK919_2586Help
Entry
LOCK919_2586      CDS       T02729                                 

Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
lcl  Lactobacillus casei LOCK919
Pathway
lcl00330  Arginine and proline metabolism
lcl00332  Carbapenem biosynthesis
lcl01100  Metabolic pathways
lcl01130  Biosynthesis of antibiotics
lcl01230  Biosynthesis of amino acids
Module
lcl_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lcl00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LOCK919_2586
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    LOCK919_2586
Enzymes [BR:lcl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     LOCK919_2586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase DRE2_N
Motif
Other DBs
NCBI-ProteinID: AGP69264
UniProt: S4ZQL9
Position
complement(2542339..2543172)
Genome map
AA seq 277 aa AA seqDB search
MAKRAMQCKRLVVKIGTSSLIHPNGKVNLQTIDRLAYALTALNNQGYELVLVTSGAIGVG
MAELGMSKRPAVIAEQQALAAIGQSELMTLYTQRFSDYGAKIGQLLLTHDVFDYPMNRQH
VLDTIDALLAQQVIPVINENDSVAVDELDHRTTFGDNDQLSALVAKQIGADLLVVLSDID
GLYDRDPNRHPDAALMPTITQLSAKVLAAAGGSSTRFGTGGMVTKLKAAKTMMRAGKQMV
LASGRDPRIVLQILAGDPVGTWFGQPKQAASVSQSFQ
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacgggcgatgcaatgtaaacgattagtagtgaagattggcacgagtagcctg
attcatccaaatggtaaagtcaatttgcaaaccattgatcgactggcctacgctttgacg
gcgctgaataatcaaggctatgagctggtgttagtcacctctggcgcaattggcgtggga
atggcggaactaggcatgtcgaaacgaccagctgtcattgccgagcaacaagcgcttgcc
gcgattggccagtcggaattgatgaccttgtacacgcagcggtttagtgattatggtgcg
aaaattggccaattgctgctaacacatgatgtatttgattatccgatgaatcgtcagcat
gtgctggacacgattgatgcgttattggctcagcaagtgattccggtgatcaacgaaaat
gacagtgtagcggttgacgagttggatcatcgcacgacatttggtgataatgaccaattg
tcggcgctagtggctaagcaaataggcgctgatttgttggtcgtcctttcagatattgac
gggttgtatgaccgtgacccgaatcgccatccggatgctgcgctcatgccgacgattacg
cagctatctgccaaagtgctggcagctgcaggcggcagttcgacgcgcttcgggaccggc
ggcatggtgacaaaactgaaggccgccaagacgatgatgcgtgctggcaaacaaatggtg
cttgctagtggtcgtgatccgcggattgttttacaaatcttggccggcgacccagtcggt
acttggttcggtcagcccaaacaagcagcaagtgtcagtcaaagttttcaatag

DBGET integrated database retrieval system