KEGG   Latimeria chalumnae (coelacanth): 102345877Help
Entry
102345877         CDS       T02913                                 

Definition
(RefSeq) L-amino-acid oxidase-like
  KO
K03334  L-amino-acid oxidase [EC:1.4.3.2]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00250  Alanine, aspartate and glutamate metabolism
lcm00270  Cysteine and methionine metabolism
lcm00280  Valine, leucine and isoleucine degradation
lcm00350  Tyrosine metabolism
lcm00360  Phenylalanine metabolism
lcm00380  Tryptophan metabolism
lcm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lcm01100  Metabolic pathways
Module
lcm_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102345877
   00270 Cysteine and methionine metabolism
    102345877
   00280 Valine, leucine and isoleucine degradation
    102345877
   00350 Tyrosine metabolism
    102345877
   00360 Phenylalanine metabolism
    102345877
   00380 Tryptophan metabolism
    102345877
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    102345877
Enzymes [BR:lcm01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.2  L-amino-acid oxidase
     102345877
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Pyr_redox_2 FAD_binding_2 Pyr_redox DAO FAD_binding_3 HI0933_like FAD_oxidored Pyr_redox_3 AlaDh_PNT_C Thi4 MCRA GIDA Lycopene_cycl ApbA Trp_halogenase UDPG_MGDP_dh_N Gln-synt_C-ter 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 102345877
NCBI-ProteinID: XP_014350919
Position
Un
AA seq 520 aa AA seqDB search
MHYVQTFNLPVEDFITDNDNTFYYVNGIHARPWEVKENPAILNYSVDENERGKSAEQLFN
SCLSKAAKTEQDPLSECFKDPDYEELLNIAKRGLPKHSSPKHIIIVGAGIAGLVAATVLE
QAGHNVTILEASDRVGGRIHTYRPHTGDWYAELGAMRLPTSHHYNGGTGTQRSAMDNLIV
NVREDLKNSNCSYVLKKYDAYSVKQYLVDVCKLSKGAVQMVGDILNDQSLFHTAFSERLR
LQAANNNKVHFKQIVGGTDRLPRAFQDRIKSPIYLNSQVIAINQTGDKVTVFYKETAYNF
FSELQADYVLITITARATKFLDFHPALSLSKIRALHAVHYGCSTKILLVFREKFWEKDKI
HGGKSITDLPSRLIFYPSHTFQSNVGVLLASYTWSDESSSFLGLSDEECIMAALNDVAKI
HGEHIRELLESGVVKKWSTDPYSLEAFALYTPYQLREYTEDLFKKEGRIHFAGEHTTLSH
AWIETAMKSALKAARNINRAADEEIPTDTKELSTEHKSEL
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgcattacgtgcagacgtttaaccttcccgtggaagactttataactgataacgataat
actttctactacgtgaacgggattcatgctagaccatgggaagtgaaggaaaaccccgct
atcctgaattatagcgtggatgagaacgagagggggaaatcagctgaacagttgttcaat
tcatgtttatcaaaggctgcaaaaacagagcaagatccactttcagaatgctttaaggat
ccagactatgaggagctacttaacattgctaaaagaggcttgcccaaacactcttctccc
aagcatattatcattgtaggggcggggattgctgggcttgttgccgcaacagtactagag
caagccggtcacaatgttactattcttgaagctagtgaccgcgttggaggacggatacac
acctacaggcctcacacaggagactggtacgctgagctaggagccatgagactgccaact
tctcaccattataacggtggtaccggcacgcagcgcagtgccatggacaatctgattgtt
aacgtgagggaagatttgaaaaacagtaactgcagttacgtgttgaagaagtacgatgct
tactctgtaaaacagtatttagttgacgtatgtaaactgagtaaaggagctgtgcaaatg
gtgggcgacattctgaatgatcaatccttgttccacactgccttcagcgagagacttaga
cttcaagctgccaacaacaacaaagtccacttcaagcaaatcgttggaggtactgatcgc
ttaccgagggcatttcaagatagaattaagagtcctatctatctgaattcacaagtcatt
gcgataaatcaaacaggtgataaggtcacggtcttttacaaggaaacggcttataatttc
ttctctgagctgcaggctgactatgttcttataacaatcacagccagagctactaagttt
ctggactttcacccagccctgtcactaagtaaaataagggcccttcacgctgtccattac
ggatgttccactaaaattctcttagtttttcgagaaaaattttgggaaaaagacaagatt
cacggtggcaagtcaatcacagacctgccctcacggttaattttttaccccagccacaca
tttcagagcaatgtgggggtgcttctggcctcttacacctggtcagatgaatccagttcc
ttcctcgggctcagtgatgaggaatgcataatggccgccctcaacgatgtagcaaaaata
cacggagaacacatccgggaactcttggaaagtggggtggtgaaaaaatggagcacagac
ccatacagccttgaggcgtttgctctgtacaccccgtaccagttaagggaatacactgag
gacttgttcaagaaggaaggaaggattcattttgctggggagcacacaaccctgtcccat
gcttggatcgagacggccatgaaatctgctctgaaggcagcaaggaacatcaaccgagct
gctgatgaagaaataccaacagataccaaagaactctccactgaacacaaatctgaactg
taa

DBGET integrated database retrieval system