KEGG   Latimeria chalumnae (coelacanth): 102346941Help
Entry
102346941         CDS       T02913                                 

Gene name
GSS
Definition
(RefSeq) glutathione synthetase
  KO
K21456  glutathione synthase [EC:6.3.2.3]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00270  Cysteine and methionine metabolism
lcm00480  Glutathione metabolism
lcm01100  Metabolic pathways
lcm04216  Ferroptosis
Module
lcm_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    102346941 (GSS)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102346941 (GSS)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    102346941 (GSS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lcm04147]
    102346941 (GSS)
Enzymes [BR:lcm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     102346941 (GSS)
Exosome [BR:lcm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102346941 (GSS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSH_synth_ATP GSH_synthase
Motif
Other DBs
NCBI-GeneID: 102346941
NCBI-ProteinID: XP_005986741
Ensembl: ENSLACG00000018278
Position
Un
AA seq 486 aa AA seqDB search
MSETEQEKEMMLDFAVWEDGLNNEETLKELVVAAKDAALLHGVLMRTKEEPNASEIVNYA
PFTLLPSPVPRACFDQAKAVQRDFNLLVDTVSQSTEFLEQVLTSVVKVDDFTARLFKIYK
QVLQEGIEQPIVLGLNRSDYMFECGEDGSTSLKQIEINTIAASFGGLASKTPAVHRHVLR
VFGKPEEASKILPNNPSKDLAEGIAKSWQLYGSNRAAVLFLVEDEQRNILDQRYVEAELW
DRNIRVIRRQFVYVSDRGSLDKDRRLFIDGQEIAVIYYRSGYEPQNYTKQNWEARLLMEQ
SKAVKCPNIATQLVGAKKVQQELARPGVLEKFLPNNPEAVSRIRSTFTGLYTLAIGEEGD
STVAMAISDPDRFVLKPQREGGGNNIYGEDIRKVLLKIKGSQEREAYILMDKIQPKPVRN
CLLRAGTPVRVSECISELGMYGVYVRHGKKMVMNECGGHLLRTKSIEHADGGVAAGVAVL
DNPYLI
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagacagaacaagaaaaagagatgatgctggattttgcagtttgggaggatggc
ttgaacaatgaagagactttaaaggagttagtggtagctgctaaagatgctgctctgctt
catggtgtcctcatgaggacaaaagaagagccaaatgcatctgagatcgtgaactatgct
ccgttcaccctgctcccatctccagttcccagggcatgttttgaccaggcgaaggcagtg
cagagagactttaacctgctggtggatactgtcagccagagtacagagtttttggagcaa
gtactcaccagtgtagtgaaggtggatgatttcacagcacgcttatttaaaatctacaag
caagttctccaagaaggcattgagcagcccattgtgttaggtttgaaccgatctgactac
atgttcgagtgcggggaggatggcagtacatcactgaaacaaatcgagattaataccatt
gctgctagctttggaggtttagcttcaaaaaccccagctgttcatcggcatgtgttacga
gtctttggaaaacctgaagaagcatcaaagattcttcccaacaatccatcaaaagacctt
gcagaaggcattgcaaaaagctggcagctatatggctctaacagggcggctgttctgttc
ttagttgaagatgagcaaagaaacatacttgaccaacgctatgtggaagctgaactttgg
gacaggaatatccgtgtaatccgtaggcaatttgtatatgtttctgacagaggatctcta
gataaggacagaagacttttcatagatggacaagaaattgcagtgatttactacaggagt
ggatatgaaccccaaaactacaccaaacagaattgggaagcacgtctattaatggaacaa
tccaaagctgtcaaatgtcctaatattgcaacccagctggtgggggccaagaaggtacaa
caggagctggcacgtcctggagtgctggaaaagtttctacccaacaatcctgaggcagtc
tcccgaatcagatccacctttacgggcctctatactcttgctataggggaagaaggagat
agcacagttgctatggcaatatctgatcctgaccgtttcgtactaaaaccccaaagagaa
ggaggaggaaataacatttatggagaagacatcaggaaggttttgttaaagattaaaggc
agccaagaaagagaagcctacatcctgatggataagattcaacctaaacctgtgaggaac
tgtctgctaagggcaggaactccagtcagagtatccgagtgtataagtgaactggggatg
tatggtgtttacgtcagacatggcaagaagatggttatgaatgagtgtggtggccatttg
cttcggacaaagagcatagagcatgcagacggaggagtggcagctggtgtggctgttctg
gacaacccttacctcatttga

DBGET integrated database retrieval system