KEGG   Latimeria chalumnae (coelacanth): 102347836Help
Entry
102347836         CDS       T02913                                 

Gene name
THNSL2
Definition
(RefSeq) threonine synthase like 2
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
lcm  Latimeria chalumnae (coelacanth)
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102347836 (THNSL2)
Enzymes [BR:lcm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     102347836 (THNSL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP Cas_Cas02710 DUF2299
Motif
Other DBs
NCBI-GeneID: 102347836
NCBI-ProteinID: XP_006007672
Ensembl: ENSLACG00000009999
UniProt: H3ANZ3
Position
Un
AA seq 478 aa AA seqDB search
MKYISTRGEASGIDFEETLFTGFAPDGGLYMPEEIPKLNVDTLRKWSTLSFTELVKEISS
LFIPPEVILRKDLNDLVDRAFSRFQHKDIVCLSQLKNKLNVLELWHGMTRAFKDLALSCM
GQLLQYVLKKSNKHVLILVVTSGDTGSSALEGVRGVDGVDIIVVLPYGRCTRIQELQMTT
VIEDNVHVFAADGTCDDIDEHARKIFADTSFCRAHGLLSLNSANWSRILLQIPHFFYAYF
RCVPSLNTTPLPEVEVVVPTGGAGNITAGCIAQKMGLPVRLVTVVNENDIIHRTIQHGDY
SLASSVKQSLAPSIDIQQPYNMERIFWLLSGMDSNLMKEIMEEFYRSGKRKLPKNLHRKV
LEVLMSCSVTDEDIVQTMKRCWEENQYLLCPHSAVAVVYHYQQSDQGNDCIPRCCLATAS
AVKFQDAVLSAGLVPEIPPDIAALEDKETRFTQMKRGEDWEKILRIKIQDITRARSVL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatatcagtacacgtggagaagcaagtggaattgattttgaggagacccttttt
actgggtttgccccagatggtggtctctacatgccagaagagatccccaaattaaatgtg
gacacactgaggaaatggagtaccttgtccttcacagaactggtaaaggagatctcttca
ctattcattcctccagaggtcatactgaggaaggacttgaatgatctggttgaccgagca
tttagcaggtttcaacacaaggacattgtatgtctctcacaactgaagaataaattaaat
gttttggaactgtggcatggaatgacaagagcatttaaagatctggctttgtcctgtatg
ggacagcttctacaatatgtcctaaagaaaagcaacaagcatgtcctcatcctagtagta
acctcaggagacaccggtagttcagctctggaaggtgtgcgtggagtggatggagtagac
attattgtagtcttgccgtatggtcgctgtactcggatacaagaactacaaatgacaact
gtgattgaagataatgtccatgtgtttgcagcggatggaacatgtgatgacatagatgag
catgcaagaaaaatatttgccgatacttctttctgccgggcacatggtttactaagcctg
aattcagccaactggtctcgaattttattacagatcccccacttcttctatgcttacttc
aggtgtgtgccatctttgaacacaactccattgcctgaagtggaagtagttgtaccaaca
ggaggagcaggaaatattacagctgggtgtattgcacagaagatgggccttcccgttcgt
cttgttaccgtggttaatgagaatgacattattcacaggaccattcaacatggagactat
tctttggctagttcagtgaaacaaagcttggctccatcaattgatattcagcaaccgtac
aacatggagagaatattttggttactttctgggatggacagcaacctgatgaaagagatt
atggaagaattttatagatcaggaaaacgcaagctgcctaaaaatctgcacagaaaggtc
ttggaagtgctgatgtcatgctcagtaactgatgaagatattgttcagacaatgaagcga
tgctgggaggagaatcagtacctgctttgtcctcactctgctgtggctgttgtttaccat
tatcagcaatcagatcagggaaacgactgtatccccaggtgttgcttagcaactgcctca
gcagtgaaattccaggatgcagtgctgtcagctggactagttcctgaaatcccaccagat
attgcagctctggaggacaaagagaccagattcactcaaatgaaaagaggagaagattgg
gagaaaatactgagaatcaaaatacaggacataacccgagcaagatctgttctgtag

DBGET integrated database retrieval system