KEGG   Latimeria chalumnae (coelacanth): 102349199Help
Entry
102349199         CDS       T02913                                 

Gene name
HTR4
Definition
(RefSeq) 5-hydroxytryptamine receptor 4
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04020  Calcium signaling pathway
lcm04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    102349199 (HTR4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102349199 (HTR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lcm04030]
    102349199 (HTR4)
G protein-coupled receptors [BR:lcm04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    102349199 (HTR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 Git3 DUF621
Motif
Other DBs
NCBI-GeneID: 102349199
NCBI-ProteinID: XP_006003005
Position
Un
AA seq 361 aa AA seqDB search
MDKESDTTDSSNNSEPSLTSTEKIVLSFFLSFIIIMTVLGNLLVMVALCKDRHLRKKKTN
YFVVSLAFADLLVAVVVMPFATVELVKGNWIYGDAFCLVRTSLDVMLTTASILHLCCIAL
DRYYAICCQPLVYRNKMTPLRVTLMLGGCWVIPSLISFVPIMQGWNSIGIHQLIEERKIG
RTTNETYCVFLVNRPYAIVCSAVAFYIPLFLMVIAYQRIYVTAKEHARQIGNLQRAGSAP
ESYDSSDNHGSHRMKIEAKAAKTLAIIMGCFCLCWAPFFITNVIDPFIDYSVPWQMWTAW
LWLGYVNSGLNPFLYAFLNKAFRRAFLMILCCGDPRYIQTGNFRSSRPYTASVNGTSVAL
R
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggacaaagaaagcgacaccacagacagttcaaataatagtgagccaagtttaacttca
acagaaaagattgttctttcattcttcctttccttcattataatcatgactgttctgggc
aatctgctagtcatggttgcattgtgtaaagacaggcatctacggaagaagaagaccaac
tactttgttgtatcattggcctttgctgatctgctggtagctgtagtggtcatgccattt
gctacagttgaattagtaaagggaaactggatatatggagatgcattttgtctggtcaga
acatccttagatgtcatgttaacaactgcatctattttacatttgtgctgtatagcatta
gataggtattatgctatttgctgtcaacccttggtgtacagaaataagatgacaccttta
cgtgtaactctgatgcttggtggatgctgggtaattccatccttgatttcctttgttcct
ataatgcaaggctggaattctattggaattcatcaacttattgaagaaagaaagattggc
agaaccacaaatgaaacttattgtgtgtttttagtaaacagaccgtatgccattgtctgt
tcagctgtggctttctatattcccctttttctgatggtaattgcttaccaacggatatac
gtaacagcaaaggagcatgctcggcagataggaaacctacagagggctggatctgcacca
gagtcgtacgacagctcagataaccatggatcccacaggatgaaaatagaagccaaagca
gctaaaacactagctattattatgggatgcttctgtttatgttgggcaccatttttcatt
accaatgttattgacccatttatagactacagcgtaccctggcaaatgtggactgcgtgg
ctgtggctggggtatgtaaattcgggtttaaacccatttctttatgcttttctgaacaaa
gcatttcgacgtgcctttttaatgattctctgctgtggggaccctagatatattcaaaca
ggaaatttcagatcatcacggccttatactgcatctgtcaatggaacgtctgtagctttg
aggtaa

DBGET integrated database retrieval system