KEGG   Latimeria chalumnae (coelacanth): 102349645Help
Entry
102349645         CDS       T02913                                 

Gene name
QRSL1
Definition
(RefSeq) glutaminyl-tRNA synthase (glutamine-hydrolyzing)-like 1
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00970  Aminoacyl-tRNA biosynthesis
lcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    102349645 (QRSL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lcm03029]
    102349645 (QRSL1)
Enzymes [BR:lcm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     102349645 (QRSL1)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     102349645 (QRSL1)
Mitochondrial biogenesis [BR:lcm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    102349645 (QRSL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 102349645
NCBI-ProteinID: XP_005997946
Ensembl: ENSLACG00000015858
UniProt: M3XK66
Position
Un
AA seq 519 aa AA seqDB search
MLGLTLREVSVALREGQIRPTELCHRCLSQIEETKFLNAYITVTEEAAFKQAEESEERFK
RGKPLGPLDGVPVAVKDNFSTAGIETTCASKMLQGYIPPFTATVVQKLLDQGAVLMGKTN
LDEFAMGSGSIDSIFGPVRNPWGYSKQYRGESSRREDPGWLIAGGSSGGSAAAVASLTCF
ASLGSDTGGSTRNPAALCGIVGLKPTYGLLSRHGLIPLVNSMDVPGILTRSVDDAATVLG
VLAGHDPKDSTTVQDHIESFELPDEIAVQNLCVGIPKEYHAPGLSSETLAAWTRAADLFE
NAGAKVVQVSLPHTQYSIVCYHVLCCTEVASNMARFDGLEFGHRSKMESSTEAMYAATRH
EGFNDVVRGRILSGNYFLLKQNYERYFLKAQKVRHLIANDFLKAFSSGVDFLLAPTTLSD
AAPYLEFTKEDNRTRSAQEDIFTQSANMAGLPAVTIPLTLSTRGLPISLQFIGRGFQEQK
LLSVAKWLEKVVKFPLIELEATAGNLQDAPKHKTFTSAL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgttgggcttgactttgagagaagtgtctgtagcactgagggaaggtcaaatccgtcca
acagaactttgccacaggtgcctctctcagattgaagaaacaaaattccttaatgcctat
atcactgtcacagaagaggctgcgttcaaacaagctgaagagtctgaggagaggtttaag
agagggaaaccacttgggcctctggatggcgttcctgttgcagttaaagacaacttcagc
acggcaggcattgaaacaacttgtgcatccaagatgttacaaggttatattccacctttt
actgccacggtcgttcagaaattgttggaccaaggtgctgttcttatgggaaaaacaaac
ttagatgagtttgcaatgggatctggaagcattgacagtatctttgggccagtgaggaat
ccgtggggatattccaagcaatacagaggagagtcttctcggagggaagacccgggttgg
ttgattgcaggagggagctccggtggcagtgcagcggcagtggcttcattaacctgcttt
gcgtctttgggctcagacacaggaggttctaccaggaatccagctgctctctgtggcatt
gtaggattaaagcctacttatggactgctttctcgccatggtcttatcccattggtgaac
tccatggatgtgccaggcattctgacgaggagtgtggatgatgcagccactgtcttaggg
gtgcttgccggacatgatcccaaagattccaccactgtacaagatcacattgagtctttt
gagctcccagatgagattgccgtccagaacttgtgcgtgggtattccaaaggaataccac
gctcctggattgtccagtgaaacgttggctgcttggaccagggcagccgacctttttgaa
aacgcaggtgccaaagttgtgcaggtgtccctgcctcatacccagtactccatcgtctgc
tatcacgtcttgtgttgtacagaagtagcatcgaacatggcaaggtttgacggactggag
tttgggcaccgcagtaaaatggagagttcaacagaagccatgtatgcagcaacaaggcat
gaagggtttaatgatgtggtccgaggacgcattctgtcaggaaattacttccttttaaaa
cagaattatgagcgttactttctgaaagcccagaaggtgcggcatctgatcgccaatgat
tttctcaaagcctttagctctggtgttgatttcttgctcgcacctactaccctaagcgac
gctgcaccgtacttggagttcactaaagaagacaacagaacccgaagtgcacaggaggac
atatttacccagtctgcaaacatggcaggtttgccagctgtgaccatccctctcacactc
tcaacgagaggcctgccgatcagccttcagttcattgggcgtggattccaagaacagaag
cttctcagcgtagctaaatggcttgaaaaagtggtaaagtttccactcattgagctagag
gccacagcaggcaacctccaggatgctcccaagcataaaacctttacctctgcgctgtga

DBGET integrated database retrieval system