KEGG   Latimeria chalumnae (coelacanth): 102349934Help
Entry
102349934         CDS       T02913                                 

Gene name
SUCLG1
Definition
(RefSeq) succinate-CoA ligase alpha subunit
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00020  Citrate cycle (TCA cycle)
lcm00640  Propanoate metabolism
lcm01100  Metabolic pathways
lcm01200  Carbon metabolism
Module
lcm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lcm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102349934 (SUCLG1)
   00640 Propanoate metabolism
    102349934 (SUCLG1)
Enzymes [BR:lcm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     102349934 (SUCLG1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     102349934 (SUCLG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 Glyco_tran_WecB
Motif
Other DBs
NCBI-GeneID: 102349934
NCBI-ProteinID: XP_006007455
Ensembl: ENSLACG00000003412
UniProt: H3A2G2
Position
Un
AA seq 326 aa AA seqDB search
MSHSRMLARLLLQQQRGVRHCSYAASRKHLYITKDTKVICQGFTGKQGTFHSQQSLEYGT
KLVGGVSPGKGGKHHLDLPVFNSVKEAKDATGAQATVIYVPPPFAAAAIIEAIDAEMPLA
VCITEGIPQQDMVRVKHKLLRQEKTRLIGPNCPGVIKPEECKIGIMPGHIHKKGRIGIVS
RSGTLTYEAVHQTTQVGLGQSLCIGIGGDPFNGTNFIDCLDVFLKDPKTEGIILIGEIGG
NAEEDAAEFLKKHNFGPNAKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKIEALQN
AGVIVSMSPAQLGNTIYKEFEKRKML
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcccacagtagaatgttggctcggcttctcttgcagcagcagaggggagtaaggcac
tgctcctatgcagcctcacgaaaacacctgtatatcacaaaagacaccaaggtgatttgc
cagggctttacaggcaagcagggaacctttcatagccaacagtctttggaatatggtact
aagttagttggaggagtgtccccagggaaggggggtaagcatcacttggacctgcctgtc
ttcaattctgtgaaggaggcaaaagatgctacaggagctcaagccacagttatctatgta
cctcccccatttgctgctgctgccattattgaagctattgatgctgagatgcctctggct
gtgtgcataactgagggaattccacagcaagacatggtacgagtgaaacataagttgctt
cgccaggaaaaaacccgtctgattggcccaaactgcccaggagtcatcaagcctgaagaa
tgtaagattggcatcatgcctggtcatatccataagaaaggaagaatcggtattgtgtct
aggtcaggtacccttacatatgaagctgttcatcagaccacgcaggttggactaggacaa
tccctttgcattggtatcggaggggatcctttcaacgggacaaacttcattgactgtcta
gatgtcttcctaaaagatcctaaaacggaaggaatcatcttaataggagagattgggggc
aatgctgaggaagatgctgcggaatttttgaaaaagcataattttggcccaaatgcaaaa
cctgtggtgtctttcattgctggtttgactgctcctccgggtaggagaatgggtcatgct
ggtgccattattgctgggggtaaaggtggagctaaagagaagatcgaagcccttcagaac
gctggagttattgttagcatgtctcccgctcagctgggtaacaccatttacaaggagttt
gagaagaggaaaatgctgtaa

DBGET integrated database retrieval system