KEGG   Latimeria chalumnae (coelacanth): 102349966
Entry
102349966         CDS       T02913                                 

Gene name
ADAMTS13
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
lcm  Latimeria chalumnae (coelacanth)
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lcm01002]
    102349966 (ADAMTS13)
Enzymes [BR:lcm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     102349966 (ADAMTS13)
Peptidases and inhibitors [BR:lcm01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   102349966 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 Reprolysin ADAM_CR_2 ADAM_spacer1 Reprolysin_4 TSP1_spondin Reprolysin_3 Reprolysin_5 TSP1_CCN Reprolysin_2
Other DBs
NCBI-GeneID: 102349966
NCBI-ProteinID: XP_005990669
Ensembl: ENSLACG00000011876
Position
Un
AA seq 1468 aa
MARSLVIIVFSFLAGFVWLRSPLQEKLFQILDVEDAFSYFGTDSVHKDRKPALQVHRRAV
NDLKHLELLVVVGPDVFQLHRQDTERYILTNLNIAAELLRDPSLGAQFRVHLIRMTILTE
PETDIQVTKNITSSLMSVCDWSNAINPQNDSDPQHADLVLYVTRFDLELPDGNRQVRGVT
QLGGACSRSWSCLITEDTGFDLGITMAHEIAHSFGINHDGTGNRCSSSGHIMASEGNHNS
VDLTWSECSREQFSKFIRTGKASCVDDLPDLEGDIPGWKPGLYFGADEQCKIAFGDTASA
CTFSRSDVDACRVLSCHTNSADRTTCTRLLMPLLDGTECGVNKWCLRGRCISLDQLNSVA
VVHGVWSSWSVFSLCSRSCGGGVTSRQRLCNNPRPAFGGQECEGPDLQASMCNIQPCSGT
QLDFMAEQCNATNTQPLYLVPRVSSFYKWVPAANYAKGDFLCKHLCRGEGKNFMVSRGDS
FMDGTRCVESSQDSVAFSSVCVAGSCRAFGCDGQLNSGKVMDQCMECGGDNTTCNKITGS
FTEGQAKEYVTFLTLPLNSTSCHVVNQKSLFTHLAVKVEGQYVVAGKGIISLNTTYPSVL
EDKQIEYKLYLTEDNLPDSEELRINGPVQDDIEIQVYRKYGKEYGDITNPSLFYSFFIPK
EDQVYLWRPVIGACSVTCGEGVKSIEYMCFDQNGEEQVEHEYCLGISRPPARGEPCHLSS
CPPSWVAGEFGPCNATCGGGVMERAIHCVSKERGSALPVAHSRCSKTPKPASAAPCNAEP
CPVRWRVLESGRCSAICGPGTAERSVICIQTLNELDVEVEDALCPAVEKPPARVPCVVNV
CPLGWDMAYNKPPQGIREDVASHTTFRLSSIREEQVYVWIPLTGNCSTSCGGGMTKVHYI
CVDHETKYEVKEERCDKTPKPEEELVPCNVQPCPPRWETEELVPCSATCGGGLTVLAVRC
VTEGKGLTKRMPHSQCSQIPQPPSVQACNTDPCPVRWSYKADTCSVTCGEGVRHRILYCA
QDRGRNEEIIADEECQGLPRPLEQEPCSMPPCPPRWKASEPGACSSVCGVGIAKRSVTCI
QNHRGQDIEVSETSCLQMEKPPSLIPCIVNLCPFSWNITSWTECSVSCGNGVRVRQDICI
NLKTGKEVSPIFCRHSPKPITVQGCYAGPCLDRIATLKPLMPNWQEANPTGSPANGMTVH
TARPVDRLGIKALPTTAAASSAVRPERANTDNTTPDSSICRKLFLSETGVLNLTGLQTED
CIFSIGAPLGEVIVIKVLYSSLNCTADESLILYERKTWLKRCTRLSGSTLNSKTNSVILR
QRQLLGQNGVVLEYWKKASTSKYYQDCDMQLFGPHGEIVNPVQPYNTEQTEACRTFINVA
PGNQIAIHALYIDLGPDTNGTLPNYIMIHDTGAMKTAAFHGNHLFFWQSVGSRAEIEFHG
DFGGKRRFRAEYWIIDSRTVVKRSRRHA
NT seq 4407 nt   +upstreamnt  +downstreamnt
atggccaggtctctggttataatagttttttcctttttagcaggttttgtttggctaaga
tcgcctctgcaagagaaactgttccaaattttggatgttgaagatgcgttctcatacttt
ggtacagactccgtacacaaagacagaaagccagccctgcaggttcacaggcgagctgtg
aatgacctgaagcacctggagctgctggttgtggtggggcctgacgtcttccagcttcac
agacaagacactgaaagatacatcctcacaaatcttaacattgcagcagagcttctcaga
gacccgtccctcggtgcacagtttagagttcatctcataagaatgacaattctgactgaa
cccgagacagatatacaagtcacgaagaacatcacttcatccttaatgagtgtctgtgac
tggagcaatgcaatcaatcctcagaatgactctgaccctcaacatgctgaccttgttctc
tatgttactaggttcgacttggagttacccgatgggaacaggcaggtccgcggggtcacc
cagctgggaggggcttgctccaggtcctggagctgtctgatcactgaggatacgggcttc
gatctgggcatcaccatggcacatgagatagcgcacagctttggaatcaaccatgatggc
acagggaacagatgcagcagcagtggtcatatcatggcttcagagggcaaccacaacagt
gtcgatcttacctggtctgagtgcagcagggagcagttctcaaagttcattcgcacaggg
aaagccagctgtgtagatgatctgcctgacctagaaggggacatacctggatggaaacct
ggcctgtattttggagcagacgagcagtgtaagatagcatttggggacacagcatcagca
tgcacctttagcagaagtgacgtggatgcctgcagagttttgtcctgtcacacaaactca
gctgatcgtacgacctgtacccgtctactgatgccgctgctggatgggactgaatgtgga
gtcaataagtggtgcctgagggggcgctgtatttctctggaccagctgaactctgttgct
gttgttcacggtgtttggtctagctggagcgtcttcagcctgtgctcacgcagctgtgga
ggcggagtcacatcccgacaacgactgtgcaacaaccccaggccagcatttggaggacag
gagtgtgaagggccggacctgcaagcaagcatgtgtaacatacagccctgctcaggaact
caactggatttcatggccgagcagtgcaatgccaccaacacacaacctctgtacctggtt
ccacgggtgtcatccttttacaagtgggtgcctgccgctaactacgcaaaaggtgatttc
ttatgcaaacacctctgcaggggagaagggaagaatttcatggtgagccggggggacagt
tttatggacggaacgagatgtgttgagagcagccaggactcagtggcattttcctctgtc
tgtgtggcaggaagctgcagggcatttggctgtgatggccagttgaattctggaaaggtg
atggaccagtgtatggagtgtggcggagacaacactacctgtaataaaattacaggctcc
tttacggaaggacaagcgaaagaatatgttacttttctgactcttcccctaaattccacc
agctgccacgtcgtcaatcagaagtcacttttcacacatttggctgtaaaggttgaaggt
caatacgtggtagcaggcaaaggcatcatttctttaaacacaacatacccttctgtcttg
gaggacaagcagatagagtataaactctacctcaccgaagacaatttaccagactctgag
gaactccgtattaatgggcctgtccaggatgacattgaaatacaggtttatagaaagtat
gggaaagagtatggagatatcaccaaccccagtctcttctacagtttcttcatacccaag
gaagaccaagtctatctgtggaggcctgtgattggcgcttgctcagtgacctgtggtgaa
ggagtgaagagcattgaatacatgtgctttgaccagaatggcgaagaacaggtggaacac
gagtactgtttaggaatttcacggcctcctgcaaggggagagccttgccacctcagctca
tgccctcctagctgggtggctggagagtttggcccctgcaatgccacgtgtgggggaggg
gtaatggagcgagccattcactgtgtgagcaaggagaggggatcagcgctccctgtggct
cattctagatgcagtaaaactcctaaaccagcttctgcagcaccctgtaatgccgaaccc
tgtcctgtaagatggcgagttttggaatctggacgatgttctgcgatttgtggacctggc
actgccgagcggtcagtcatttgcatccagactttgaacgaattggatgtggaagtcgaa
gatgctctttgtcccgcagtggaaaagcctccggctcgtgtcccttgtgtggtcaatgtc
tgccctctgggctgggacatggcatacaacaagccaccacaaggcatcagggaggatgtt
gcttcacacaccacgttcaggctgtcttcgataagggaagagcaagtctatgtttggatc
cccctgactggaaactgttccacctcctgtggaggagggatgactaaggttcactacatt
tgtgtcgatcatgaaactaaatatgaagtgaaggaagagaggtgtgacaagactccgaaa
cctgaagaagaactggtaccctgtaatgtacaaccatgcccaccaaggtgggagactgaa
gagcttgtgccttgtagtgccacctgtggaggagggcttacggtgctcgctgtccgctgt
gtgacggaggggaaaggcttgaccaaaaggatgccacattctcagtgcagtcaaattccc
cagccaccttccgttcaggcctgtaacacagacccctgccctgtaaggtggagttataaa
gcagatacgtgtagtgtgacctgtggtgagggagtgaggcatcggattctgtactgtgcc
caagacaggggtaggaatgaagaaatcattgctgatgaagagtgccagggcctgccacgt
ccgttggagcaggagccttgtagcatgcctccttgccctccaaggtggaaggcctctgag
ccaggagcctgctcttctgtctgcggagttggtattgccaagcgttcagtaacctgcatc
cagaaccacaggggtcaggacattgaagtcagtgaaacctcatgtctgcaaatggaaaaa
cctccttcccttatcccttgcattgttaacctgtgtcccttcagctggaacatcacgagc
tggacagagtgctccgtctcgtgtggcaacggggttcgagtccggcaggatatctgcatc
aacttgaaaaccgggaaggaagtgagccccatcttttgcaggcactccccaaaaccgatc
actgtgcagggctgctatgccggcccctgcctggaccggattgccactctgaagcccttg
atgccaaactggcaagaagctaaccctaccggcagccctgcaaatgggatgaccgtgcac
acggcccgtccagtggacagattggggataaaggcactacctactacagctgcagcttct
tcagctgtaagacctgaaagagcaaatactgacaacacaactccagatagcagtatctgt
aggaagctcttcctgagtgaaacgggagttcttaatttgactggcttgcagacagaggat
tgcatattttctattggagctccgcttggagaagtcatcgtcattaaagttctttacagc
tctttaaactgcacggcagatgagagtttaatactctatgagcgaaagacatggttgaag
agatgtacaagactcagtggatctaccctaaactcaaaaaccaattcagtcatccttcgg
caacgccagctgctgggacaaaatggggtagttttagagtactggaagaaggcctcaaca
agtaaatattatcaagattgtgatatgcagttgtttggaccgcatggtgaaattgtgaat
ccggtacagccttacaacacagagcagaccgaggcttgccgtacctttatcaacgtggca
ccagggaatcaaatagccatccatgctctctacatagacctggggccagatactaacgga
acgctgccaaactacatcatgatccatgatactggagccatgaaaacagcagcatttcac
gggaatcacttgttcttctggcagtcagtggggagccgtgcagagatcgagtttcatgga
gattttgggggaaagcgccgtttcagagcagagtactggatcattgactcaaggactgtt
gtgaagaggagtagaagacatgcataa

DBGET integrated database retrieval system