KEGG   Latimeria chalumnae (coelacanth): 102350144Help
Entry
102350144         CDS       T02913                                 

Gene name
CACNG7
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit gamma 7
  KO
K04872  voltage-dependent calcium channel gamma-7
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04010  MAPK signaling pathway
lcm04260  Cardiac muscle contraction
lcm04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102350144 (CACNG7)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102350144 (CACNG7)
   04261 Adrenergic signaling in cardiomyocytes
    102350144 (CACNG7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lcm04040]
    102350144 (CACNG7)
Ion channels [BR:lcm04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102350144 (CACNG7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Claudin_2 PMP22_Claudin DUF716 Claudin_3 DUF202
Motif
Other DBs
NCBI-GeneID: 102350144
NCBI-ProteinID: XP_006009720
Ensembl: ENSLACG00000006984
Position
Un
AA seq 278 aa AA seqDB search
MSNCSSRALTLLSSVFGACGLLLVGIAVSTDYWLCVEEGIVLQQNQTTEVKMALHSGLWR
VCFIAGRETGRCVASDYFLNWESEEAITTENTANILKMVRTATPFPMVSLLFVFTAFVIS
NIGHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPKGSELYFQYHYGWS
FAFAASSFLLKEGAGVMSVYLFMKRYAEEEMYRPHPALYRPRLSDCSDYSGQFLHPDIWQ
RGRSPSDISSDVSIQMNPSGYPPALKYPEHIRMSTSPC
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgagtaactgtagcagcagggcgctgaccctcctgagcagcgtgttcggggcctgcggg
ctgctgctggtggggatcgcagtcagcactgactactggctctgtgtggaggagggcatc
gtcctgcagcagaaccagaccactgaggtcaagatggcgttgcactccggcctctggcgg
gtctgctttatcgcaggacgagagacagggagatgcgtggcatcagattactttctgaac
tgggagtctgaggaggcaattactacagaaaacacagcgaatatacttaaaatggttcgt
actgccactcccttcccaatggtgagcctcctttttgtgttcactgcttttgtcatcagt
aacattggccacatccgcccacagaggacaattctggcttttgtgtccgggatctttttt
atactttctgggctctccctagtggttggactagttctctacatctccagtatcaatgat
gaggtgatgaatcgtccaaagggctcggagctgtattttcagtaccattacggctggtcc
ttcgctttcgctgcttcatctttcctgttgaaggagggagccggcgtgatgtccgtttac
cttttcatgaagcgttatgcggaagaggagatgtaccggccccacccagccctgtaccgg
ccgcggctcagcgactgctcagactactcaggccagttcctgcacccggacatctggcag
cgcggacgcagcccctcggacatctccagcgacgtctccatccaaatgaaccccagcggc
tacccgccggcactgaaatacccagagcacatccgcatgtcaacctccccctgttaa

DBGET integrated database retrieval system