KEGG   Latimeria chalumnae (coelacanth): 102350372
Entry
102350372         CDS       T02913                                 

Gene name
AHRR
Definition
(RefSeq) aryl-hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
lcm  Latimeria chalumnae (coelacanth)
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lcm03000]
    102350372 (AHRR)
Transcription factors [BR:lcm03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102350372 (AHRR)
SSDB
Motif
Pfam: PAS PAS_3 HLH PAS_4 PAS_11 PAS_9
Other DBs
NCBI-GeneID: 102350372
NCBI-ProteinID: XP_014346104
Ensembl: ENSLACG00000010268
Position
Un
AA seq 766 aa
MIPPGECMYAGRKRRKPIQKQKPAAVNEKSNPSKRHRDRLNAELDRLASLLPFPPDVISK
LDKLSVLRLSVSYLRVKSYFQAIQDKQSKKQDANQAVKEDSSAPEDLTLEGDLLLESLNS
FALVVSADGMIFYASSTIVDYLGFHQTDVMHQNVFDYIHVDDRQEFRRQLHWAMNPPHLV
HGQEHHSEGEIGEEYFLSNLFKAQDYDNVAPEYSSFLNRCFICRVRCLLDSTSGFLTMQF
QGRLKFLYGQKKATASGATLPPQLALFCMAVPLLLPSITEMKMKSMLLRAKQKTCVNAVA
DTKLKGVSNLGETDPHNKTGYQYVNFTDMLHSAENQIRLMNRGENGLSIFRVLTSDNQWV
WVQANTQVMYRNGCSEYIIVPQQGANKNEEDEYFPKQNVNGLKESRDVVLHSCTSEVAGG
LKQHHWAAAAARVAKDEIKQKCEPLKSDSYFIQDEPINFCRSLINVPKISSTNNAWTSRN
STSSQMIKNCHSIDNASGKTLKPVYSENQGILNTCPRYLHKRESMKLHPSCTGLQHLNME
SYTIEDVKSENALMSSAPYYNTGMPLDTPIKIENDSDSENGSDVYVCSQSQAWLAKEDMG
KKFLMSFPEMGHLKVEPSPSEQPSPCQKTKHNIHSSLTGHYSVSSNASNPSRPFKGINNK
GMTQFSSQQLSHSDSLCSAQSTNCLSGPNYNYSSLEDKEFGDQLYKLQYESKGHNLAHTI
KREPLDSPSWCENDQESMQSTFQKNLMPNCLTSSMSQKTTQFAFLQ
NT seq 2301 nt   +upstreamnt  +downstreamnt
atgatcccaccgggggaatgcatgtatgctgggaggaaaagaagaaagcctattcaaaag
caaaaaccagcggcagtgaatgagaagtccaatccatcaaagaggcacagagatcgtctg
aatgctgagttagaccgtctggccagtctcctgccattccctcctgacgtaatttctaaa
ttggacaaactctctgttttacgtcttagtgtgagctatctcagggtgaagagctatttt
caagctattcaagacaagcaatctaaaaagcaagatgctaatcaggcagtaaaggaagac
agctcagcccctgaggaccttacactagaaggagacttattattagaatcactgaacagt
tttgcgttggtggtgagtgcagatgggatgatcttctatgcatcttccactattgtggac
tatctcggctttcatcagactgatgtgatgcaccagaatgtgtttgattacatccatgtg
gacgatcgacaggaattccgaagacagcttcattgggccatgaaccctccacatctggtg
catgggcaggagcatcattctgaaggagaaattggtgaagagtattttctcagcaattta
tttaaggcccaagactatgacaatgtggcaccagagtactcatctttcctgaaccgctgc
ttcatttgccgggtccgttgtctgctggacagcacatctggttttctgacgatgcagttc
caaggcagactgaagttcctctatgggcaaaagaaagcaacagcgtcaggagcaacttta
ccaccacagttggctctgttctgcatggctgtgcccctcttgcttccatccatcacggag
atgaaaatgaaaagcatgcttcttagagcaaaacaaaaaacatgtgtaaatgctgtggct
gataccaaattaaaaggcgtttcaaacttgggtgagacagacccgcataacaaaactggt
tatcagtatgtcaacttcacggacatgttacacagtgccgaaaaccagataagactgatg
aatcgaggagaaaatggcctgtctatattcagagtgctgacaagtgataatcagtgggtt
tgggtgcaagccaatactcaagtcatgtatagaaacggctgctcagagtatattattgtc
ccacagcaaggggcaaataaaaatgaagaggatgagtattttccgaagcaaaatgtcaat
ggattgaaagaaagcagagacgttgttttgcatagctgcaccagtgaagtagctggaggc
ctaaaacaacatcactgggcagcagcagcagcaagagtagcaaaagatgagataaagcaa
aaatgtgaacctcttaaaagtgactcctatttcattcaagatgaacctattaatttttgt
agatcacttataaatgttccaaaaatttccagtactaataatgcatggacaagtagaaac
tctacaagctcccagatgataaagaattgtcacagtattgacaatgcttcaggcaagaca
cttaaacctgtttacagtgaaaaccaagggattttaaatacgtgtccaaggtatctccat
aaaagagagagcatgaagcttcacccgtcctgtacaggtttacagcatcttaatatggaa
agctacactatagaagacgtgaagtcagagaatgccttaatgtcctcagccccatactac
aatactgggatgcctctggatacaccaatcaaaatcgagaatgattctgattccgaaaat
ggatctgatgtttatgtgtgttctcaaagtcaagcctggctggccaaagaagacatggga
aaaaagtttttaatgagctttcctgaaatgggccatctcaaggttgagcccagtccctct
gagcagccatctccctgtcagaaaacaaagcacaatattcactcgtcacttactggacac
tacagtgtatcaagcaatgccagcaatccaagcagacctttcaaaggaataaataacaaa
ggaatgactcagtttagttcacagcagttatctcattccgatagcctatgcagtgctcaa
agtacaaactgtttaagtggtccgaactacaattatagttcgttggaagataaagagttt
ggggaccagttatataaactgcagtatgagtccaaaggccataatttggcccacacaatc
aagcgtgagcctctggactccccatcttggtgtgaaaatgaccaagaaagcatgcagtca
acatttcagaaaaacctgatgccaaactgtttgaccagctccatgtctcaaaaaacaaca
cagtttgcttttctacagtga

DBGET integrated database retrieval system