KEGG   Latimeria chalumnae (coelacanth): 102351206Help
Entry
102351206         CDS       T02913                                 

Definition
(RefSeq) cytosolic phospholipase A2 zeta-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00564  Glycerophospholipid metabolism
lcm00565  Ether lipid metabolism
lcm00590  Arachidonic acid metabolism
lcm00591  Linoleic acid metabolism
lcm00592  alpha-Linolenic acid metabolism
lcm01100  Metabolic pathways
lcm04010  MAPK signaling pathway
lcm04217  Necroptosis
lcm04270  Vascular smooth muscle contraction
lcm04370  VEGF signaling pathway
lcm04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102351206
   00565 Ether lipid metabolism
    102351206
   00590 Arachidonic acid metabolism
    102351206
   00591 Linoleic acid metabolism
    102351206
   00592 alpha-Linolenic acid metabolism
    102351206
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102351206
   04370 VEGF signaling pathway
    102351206
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102351206
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102351206
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102351206
Enzymes [BR:lcm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102351206
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2 cPLA2_C2
Motif
Other DBs
NCBI-GeneID: 102351206
NCBI-ProteinID: XP_005990844
Ensembl: ENSLACG00000018051
Position
Un
AA seq 856 aa AA seqDB search
MKVHFNKQQLGSVLPHGSMFTRISVRTLPVLATVMCKEDYEEPEKSPATYQKTSSSYYNL
SVRIIRGRNISGKDLLSKPDCYISLSLPTATAKGDKTKVINNSCNPVWNEAFHYRIQSQI
KNVLDLSMYDNDVLHDDLFSQISIDVNQIKAGEKFQHTFHVGKKKDEVLEVELVMEKSPD
PPTEVITNGVLVACPILCTEVTVNRERKNFLHGDESLVLKVNGAFEEEQKNTYKAGLGLL
GGRESFIFHRTKDIDTQLEVERMCLTTNPHTALNDQERNVLTLPLNSLSSEKETVLNRKV
PLGKGRNVDIEVQNKVCSKDLDVRLNFDLSEDEKNFLEKRLAQVACAMTKSLGLNGSLDH
EEVPVVAVVGSGGGTRAMTSLYGSLLGLQKLDLLDCITYINGVSGSTWCMSTLYEDADWS
HKQLQDPVFSAQNCVSRKKAGAFSPEHLYYYYNEKTSKKLQRQKMTIADLWGLIIEYMLY
GKKNPEKLSNQKEAVLHGQNPYPIYTAVNIRDHMDGQNFAEWCEFTPHEIGFPKYGAFIR
TENFNSEFFMGRMIRKCPEPRICYLLGLWSSIFSMNLIEAWTVTTKSSNKWLNWLKKAKE
NSDDDHLPYIMDNTESKYQLISPPGVTSYFKDFFTDRPAIGEYYNFLHGLQIHRTYKKWN
AFVRSKDHPDNYPNQLTPSERKLHLVDSGFACNNGIPLVVRPVRNVDVILSYNYTWGSQF
KALKLAEKHCVECQIPFPKIDVSEINEANLKECYMFMDKDDPRVPIVLHFPLVNDTFRHF
KAPGIQRCSAEENAEGKVDVRSRNSPYRTRNITYTPQDFDQLVSLQCYNVTNNRDSILEA
FRLAVDRRRLRLASPR
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttcactttaataagcagcagttaggatcggtgttgccccatggaagcatgttc
accagaatctcagtccgaactctacctgtcttagcgacagtcatgtgcaaagaagattat
gaagagccagagaagtcgcctgccacctaccagaagacaagttcctcctattacaacctt
tcagtaagaatcatacgaggaagaaacatctctggaaaagatttattgtcaaaacctgac
tgctacatctccctgagtctgccaacagcaacagcaaaaggtgacaagacaaaggttatc
aacaactcctgtaatccagtttggaatgaagcctttcactacaggatccagagtcagatt
aagaatgtgttggacctgtccatgtatgataatgacgtcctccatgatgacctcttctca
caaatatccattgatgtcaaccagattaaagcgggagaaaagttccagcatactttccat
gtaggcaagaagaaagatgaagtacttgaagtggagctagtaatggagaaaagcccagat
cctcctactgaagttatcacaaatggagtccttgtggcttgtcccatcttgtgtactgaa
gtaacagtgaatagagagaggaagaattttctacatggtgatgaaagccttgtactaaaa
gtgaatggggcctttgaagaggaacagaagaacacatacaaagctggccttggtctcctt
ggtggccgggaatcctttatcttccacaggactaaagacatagatactcaactggaagtt
gaacgaatgtgcctcaccactaaccctcacactgctttaaatgaccaggagaggaatgtt
ctgacactgcccctcaattccctttcttctgaaaaagagacagtgctaaatagaaaagta
ccacttggaaaaggcagaaatgtagacatagaggtccagaataaagtatgttctaaggac
cttgatgtccgactaaactttgacctttctgaggatgaaaagaatttcctggagaagaga
ctggctcaagtggcgtgtgctatgactaagtctctgggactaaatgggagcttagaccat
gaggaggttccagtggtggcagtagtgggatcaggaggtggaacaagagcaatgacatca
ttgtatggcagtttattaggactacaaaagcttgacctcctggactgtatcacttacatt
aatggagtttcaggctcgacctggtgcatgtccaccttgtatgaagatgcagattggtcc
cataagcaattgcaggatccagtattttcagcccaaaattgtgtgtcccgtaagaaggct
ggtgcattttctccagagcatctatattattactataatgagaagaccagcaagaaacta
cagagacagaaaatgactattgcagatctgtgggggctcataattgaatacatgttatat
ggcaagaaaaatccagaaaagctttccaaccagaaagaggcagtgttgcatggccagaac
ccctaccctatctatacagctgtaaatatcagagatcacatggatgggcaaaactttgca
gaatggtgtgaatttactccacatgagatcggcttccccaaatatggagccttcatacgg
acagaaaactttaacagtgagttcttcatgggaaggatgataagaaaatgccctgaacct
cggatctgctacctgctagggctgtggagcagcatcttctcaatgaatctgattgaagca
tggaccgttacaaccaaatccagcaataagtggctgaattggctcaagaaagcaaaggaa
aactcagatgatgaccaccttccctatataatggacaatactgaatcaaagtaccagctc
atcagcccacccggggtcacttcttacttcaaggatttttttactgatcggccagcgata
ggagagtattacaacttcttgcatggtttacaaatccacaggacatacaagaagtggaat
gcgtttgtaagatctaaagatcaccctgacaactacccgaaccaactgaccccttcagag
aggaagctgcacctggtggattcggggtttgcctgtaataatgggatccctctagttgtc
aggccagtcaggaacgtcgatgtcatcctctcatataactatacctggggctcacagttc
aaggccctaaagctggctgagaagcactgtgtagaatgccaaatcccattcccgaaaatt
gacgtgagtgagataaatgaagccaacctcaaggaatgttacatgtttatggataaggat
gacccccgggttcccatagtgcttcacttcccactagtcaatgacactttcaggcacttc
aaggctccaggcatacagcgatgttccgctgaggagaatgctgaagggaaagtggatgtc
agaagtcgaaactcaccataccgcaccaggaatattacctacacacctcaggactttgac
caactggtgtctctgcagtgctacaatgtcacaaacaacagagactcaattcttgaggcc
ttccgactggctgtggacaggaggagactcaggctggcatcaccaagataa

DBGET integrated database retrieval system