KEGG   Latimeria chalumnae (coelacanth): 102352055Help
Entry
102352055         CDS       T02913                                 

Gene name
MAOB
Definition
(RefSeq) monoamine oxidase B
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00260  Glycine, serine and threonine metabolism
lcm00330  Arginine and proline metabolism
lcm00340  Histidine metabolism
lcm00350  Tyrosine metabolism
lcm00360  Phenylalanine metabolism
lcm00380  Tryptophan metabolism
lcm00982  Drug metabolism - cytochrome P450
lcm01100  Metabolic pathways
Module
lcm_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:lcm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    102352055 (MAOB)
   00330 Arginine and proline metabolism
    102352055 (MAOB)
   00340 Histidine metabolism
    102352055 (MAOB)
   00350 Tyrosine metabolism
    102352055 (MAOB)
   00360 Phenylalanine metabolism
    102352055 (MAOB)
   00380 Tryptophan metabolism
    102352055 (MAOB)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    102352055 (MAOB)
Enzymes [BR:lcm01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     102352055 (MAOB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 Thi4 FAD_binding_3 Pyr_redox_2 Pyr_redox_3 HI0933_like FAD_oxidored Pyr_redox Lycopene_cycl GIDA AlaDh_PNT_C FMO-like NAD_binding_9 TrkA_N MCRA 3HCDH_N IlvN GDI K_oxygenase
Motif
Other DBs
NCBI-GeneID: 102352055
NCBI-ProteinID: XP_006001398
Ensembl: ENSLACG00000012844
UniProt: M3XHS0
Position
Un
AA seq 522 aa AA seqDB search
MTSNKYDVIVIGAGISGLSAAKLLTESGLNVVVLEARDRVGGRTFTTRNKHVKYVDLGGA
YVGPTQNRILRLSKELGIETYKVNEVERLIHHVKGKSYPFRGPFPPMWNPIAYMDYNNLW
RTMDEMGKEIPKEAPWKAPHAEEWDKITMKDLIDKICWTGVAKQFATLFVNVNVTSEPHE
VSALWFLWYVKQCGGTTRIFSTTNGGQERKFVGGSSQISEKMMDLLGDQVKLQRPVVGID
QSGEDVVVETLNREKYEAKYVISAIPPTLSVKIHYNPPLPPLRNQLIHRVPLGSVIKCMV
YYKDSFWRKQDYCGSMIIEEEDAPIGLTLDDTKPDGSVPAIMGFILARKARRLAHFTKEE
RKKKICELYARVLGSQEALQPVHYEEKNWCEEEYSGGCYTAYFPPGIMTQFGKVIRQPVG
RIFFAGTETATEWSGYMEGAVQAGERAAREILCSMRRIPESEIWKPEPECLDVPASPITT
AFWERNLPSVPGFLRLLGFSAFLTSTAAVGLFAYKRGLLIKN
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcaataaatatgatgtaattgtcattggagcaggcatctcaggtctgtcggct
gccaagctgctgactgagtctgggctgaatgtggttgtgttggaggcccgtgacagggtt
ggaggaagaaccttcaccaccaggaataagcatgttaagtatgtggaccttggcggagcc
tatgtggggccaacgcagaatcgcattctacgcctgtcgaaggagctgggcattgagacg
tataaagtgaatgaagtggaacgcctcatccatcatgtcaagggtaagtcgtatcccttt
aggggtcctttccctcctatgtggaaccccattgcctatatggattacaacaacctgtgg
agaacaatggacgaaatggggaaggagatccccaaggaagccccgtggaaggccccacat
gctgaagaatgggataaaattaccatgaaggatctgattgacaaaatctgctggacaggt
gttgccaagcagtttgccacgctgtttgtgaatgtcaacgttacttctgaaccccatgag
gtctctgctctctggttcctgtggtatgtgaagcagtgcggtggaacgaccaggatcttt
tcaacaaccaatggtggacaggagcgtaagtttgttggcggttcaagccagatcagtgag
aagatgatggatctccttggagatcaggtgaaactgcagagacctgtagtcggcattgat
cagtctggggaggatgtggtcgtggagactctaaaccgtgagaagtatgaggccaaatat
gtcattagtgccattcctccaacccttagtgtgaagattcactacaacccacctttgccg
cctttgagaaaccagttaatccatcgtgttcctttgggatccgttatcaagtgcatggtg
tattacaaggactcattttggagaaagcaggattactgtggcagcatgataattgaagaa
gaggatgctccaattgggctgacactggatgacaccaaaccagatggcagtgtgcctgcc
attatgggattcattcttgcccgaaaagccagaagactagcacatttcaccaaagaagag
cgaaagaagaaaatctgtgaactttatgcaagagttcttggatcacaggaagctttacag
cctgtacactatgaagagaagaactggtgtgaggaggagtactcgggcgggtgttacact
gcttacttcccaccaggaataatgacccagtttggcaaggtaatccgtcagccagttggc
agaattttctttgccggcactgagacggctaccgagtggagcggctacatggagggggca
gtgcaggctggagagagagcagccagagagatcttatgttcaatgagaagaattcctgaa
agtgaaatctggaagcctgagccagagtgtctggatgtcccagcttctccgatcaccacc
gcgttctgggagaggaaccttccatctgtccctgggtttctgaggctgcttggattctcc
gcgtttctcacctcgacagcggcagtagggctctttgcctacaagaggggactgctgatt
aagaactga

DBGET integrated database retrieval system