KEGG   Latimeria chalumnae (coelacanth): 102352683Help
Entry
102352683         CDS       T02913                                 

Gene name
DOCK8
Definition
(RefSeq) dedicator of cytokinesis 8
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
lcm  Latimeria chalumnae (coelacanth)
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lcm04131]
    102352683 (DOCK8)
Membrane trafficking [BR:lcm04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    102352683 (DOCK8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398
Motif
Other DBs
NCBI-GeneID: 102352683
NCBI-ProteinID: XP_005999456
Ensembl: ENSLACG00000004372
Position
Un
AA seq 2107 aa AA seqDB search
MATLSGSDRRAFALKINRHSSAEIRKQFTNQYGFVPFHHQHSQSISGSQTLCLPFYDALE
PVDFEEFLMTQLNNLDPDFVQELGDFPEDDLETEFIHRECRTVRPSVPEEGVELDPHVRD
CVQTYTQEWLIVNRKFQGESGSGNFYKITSQKDFHKTLQKQLFESDVDASSLNHQSSSRR
LAVQCDESGRTTLASSDFDLRGIQPDSRLENLLQPISPEDTDRQNEETRKENRQAELFAL
YPITDEEDAVEIRPIPDCPKEHLGYRILIKLQSLKFEIEIEPLFASIALYDLKERKKISE
NFYCDLNTDQLKGFLRSHVPSIAMSSQAKSAIFSITYPSPDIYIVVKIEKVLQQGEISDC
AEPYMVMKESDATKNKDKIEKLKGQAESFCQRLGKYRMPFAWCPINIMSIIASTTIERDS
PDFESANGKGAPGDRRTLGPSRRTIERFNTLEDCYNLSGFKSTVLTPSILFKQEGDRLSD
EDLFKFLADSKRIASLQRKLKTIPGFLKLEISPAPESISNCLTPELLPVVPFPENRSRPI
KEVLEFPSREVYVPHTTYRNLLYVYPQRLNFANRLASARNITIKIQFMSGEDPSCAMPVI
FGKSNGPEYVQEVYTAITYHNKSPDFYEEVKIKLPAKLTEKHHLLFTFCHISCQQKQNQG
SSVESLIGYSWLPILANERLQIGHYCLPVALDKLPTNYSMHSPEKVPSQSPPIKWVEGHK
GVFNIEVQGVSSVHTQDNHLEKFFTLCHALEGRVTFPIRIQDQKIMENNLEHELKLSIIW
LNSSRLEPLVLFLHQVLDKLFQLTVQPMVIAGQTASLAQYAFESVVSIVNSLHNSTDLSK
DQHGRNCLLAAYVYYVFRLPDSLQDMMTPGSAMTAILPETRYYTVGRSTAASVGSRLMQS
RILSSSNPDITVPQATADEEVKNIMSKGLDRCGNRMSSYVQVNTYFQSAGAIPRPVNKKL
FHEELALQMVVSTNVVRENVFKYAWFFFELLVKSMAQYICNSEKHDGPRRSRFSDRFKDD
ITTIVNVVTAEIGTSLSKQQKETEQAEKINISLAFFLYDLLSLMDRGFVFILIKNYCNQL
GAKLNSVPTVIPMRLEFLRILCSHEHYLNLNLFFVNSALSAPASPCPSISSQNSSSCSSF
QDQKIANMFDLTTEYRQQHFLTGLLFSELATALDQETEGIVRVQRKAINAVQSLLCSHDL
DQRYIKPELKTKIAALYLPLVGIILEALPQLCDFTVSDARNKGRPSSQDEESEAINPINQ
SVAMAIAGNPLSSLLKNTVSAATTLPSKQYNALTAETSRNLLICFLWIMKNADHSLIQKW
TVDLSTTQLNKILELLYIGVSCFEYKGKSSSDKVSTQVLQKSRDAKARLEEALLGGAGAR
GEMMKRCRIPAGNERFQGVNENLRWRKDQMQWRQNNERLDKTKAELDQEALISGNLATEA
NLIILDMLETITQGIAASDCKDNVLGGVFRVLLHSLSCNQSSIYLKHCFSTLRALIIKFG
DLLFEEEAEQCADLCQRVLHHCSSSIDSTRTQACATLYIIMRYSFSNPSNFSRVKMQVTM
SLASLVGKSSDFNEVYLRKSLRTILAYGEEDEEMQPTLFPVQVYEMLCNLNSILSDTVKM
REFQEDPEMLMDLMYRIAKGYQTSPDLRLTWLQNMAEKHSTRKCYTEAAMCLVHAAALVA
EYLSMLEDHSYLPVGSVSFQNISSNILEESAVSDDVLSPDEDGICSGKYFTESGLVGLLE
QAAECFSVAGLYETVNEVYKVVIPILEAHRDFRKLTSTHDKLKKSFDSIISKGHKRMFGT
YFRVGFYGSKFWDLDEQEFIYKEPTITKLPEISHRLEGFYGQCFGEESVEVIKDSTPVDN
TKLDPSKAYIQITFVEPYFDEYEMKDRITYFEKNFNLRRFMYTTPFTLDGRPRGDLKDQY
KRKTILTTMHAFPYIKTRINVIQKEEFILTPIEVAIEDMQKKTLELAVATSQEPPDAKLL
QMVLQGSVGATVNQGPLEVAQVFLAEIPVDPKLFRHHNKLRLCFKEFIMRCGEAVEKNKR
LITVDQKEYQQELKKNYNKLKENLRPMIERKIPELYKPIIKVCSERSDSCRSSLRRYETQ
SSVPQNS
NT seq 6324 nt NT seq  +upstreamnt  +downstreamnt
atggccactctgtccggctccgacaggagagcgtttgctctgaagatcaacaggcattcc
tcagcagaaataagaaagcagtttaccaaccagtatggctttgtaccatttcaccaccaa
cacagccaaagtatatctggctcacaaacactttgtctcccattttatgacgctttggaa
ccagtggactttgaagagttcctaatgacacagttgaacaacctagacccagactttgtg
caggagctgggtgactttccagaggacgatttagagactgagtttattcatcgagaatgc
agaactgtgcgtccttcagtgccggaagagggggttgagttggatccacatgtccgggac
tgtgttcagacatatactcaggagtggctgattgtaaacagaaagtttcaaggagagtct
ggaagtggtaacttttacaaaatcacatcccaaaaggatttccacaaaactcttcaaaag
cagctgtttgagtcagatgtagatgccagcagcctgaatcatcagtccagttccagacgc
ctggctgtccagtgtgatgagtctgggaggacaacactggcatcatcagactttgatctg
cgaggcattcaaccagatagccgactggagaacctgctgcagcctatcagtccagaggac
acggacaggcaaaatgaagagacaaggaaggaaaacaggcaggccgagctgtttgccctt
tatcccatcactgatgaggaagatgcagtggagatacgcccaattcctgattgtccaaaa
gaacaccttggttacaggattctcattaaattacaaagtttaaagtttgagattgaaatc
gagccattgtttgccagtatagcgctgtacgatcttaaagagaggaaaaagatttcagaa
aatttttactgcgacctgaacactgaccagctcaagggatttctccgttctcacgtgccc
agcatagccatgtccagtcaagctaaatcagccatcttttccatcacgtacccttcaccg
gatatctacattgttgttaagattgagaaagtgcttcagcagggagagattagtgactgt
gcagagccgtacatggtgatgaaagaaagtgatgctacaaagaacaaagacaaaattgag
aaactaaagggccaagctgaatccttctgccagcgtttagggaaatacaggatgcccttt
gcctggtgtcctattaacattatgagtattatcgcctcaacaacaattgaaagagattca
cctgactttgaaagtgccaatgggaaaggagcacctggagacaggaggacactgggacca
agtagaagaaccatagagagattcaacaccttggaggactgttataacctatcaggtttc
aagtccacagtgcttaccccaagcatacttttcaaacaggaaggggacaggcttagtgat
gaagacttgttcaagttcttagccgactccaagagaatagcttcattgcaaagaaagcta
aagacaataccaggctttctgaaactggagatttcaccagctccagagagtatttccaat
tgcctcactcccgaattgttaccagtagtaccatttcctgaaaaccgcagccgtccgatc
aaagaagtcctggagttcccgtctcgggaagtctatgttcctcatacaacttaccgaaat
ctcctttatgtttacccacagaggctgaattttgccaaccgactggcatcggcaagaaat
attaccatcaaaattcagttcatgtctggtgaggacccaagctgtgcaatgccggtcatt
tttgggaagtccaatggtccagaatatgtacaagaggtgtatactgctattacctaccac
aacaagtcccctgatttttatgaagaagtgaaaatcaaactgccagctaaacttacagag
aagcaccacctcctattcactttttgccacatcagctgtcagcagaagcagaaccagggc
agttcagtagagagcctcattggatattcttggctgccaattctagcaaatgaacgtcta
cagattggccattattgtcttcctgtagctttggacaagctaccaaccaactactcaatg
cactccccagagaaagtcccatcccagtcgccgcctatcaaatgggttgaaggacataaa
ggagtatttaatattgaagtgcaaggtgtttcatctgtacacactcaggataaccatctg
gagaagttcttcactctgtgccatgccctggaaggaagggttacatttccaattcgcatc
caggatcagaagataatggagaataatcttgaacatgagctgaagctcagtattatctgg
ctgaattcctctcggcttgaacccctcgtcttattcctacaccaggttttagacaaattg
tttcagctgactgtgcagcctatggtcattgcaggccaaacagccagtcttgcccagtat
gcttttgagtcagtcgtgtcaatagtgaacagcctccacaacagcacagacctgagtaaa
gaccagcatggcagaaactgtctgctggcagcctacgtgtactacgtgttccgcttgcca
gattctctgcaagacatgatgacgccaggctctgcaatgacagccatcctcccagaaact
cggtattatacagtgggacgctccaccgctgcctcagtcggctccagactcatgcaatcc
agaatcctcagcagcagcaatccagacatcactgtccctcaggcaacagctgacgaagaa
gtcaaaaatatcatgtctaagggattggatcgctgtggtaatcggatgtcttcctatgta
caagttaacacctacttccaaagtgcgggtgccattccaaggcctgtgaataaaaagcta
tttcatgaagagttagctctgcagatggtggtcagtaccaatgtagtaagagaaaatgtc
ttcaagtatgcttggttcttctttgaactcctggtgaaaagcatggcccagtacatttgc
aactcagaaaaacatgatgggcctcgcaggagtcgtttttcagaccgtttcaaggatgat
atcaccacaatagtcaacgtagtcactgcagagattgggacaagtttatctaaacagcaa
aaggaaactgaacaagcagagaagatcaacattagcttggcattttttttgtatgacctg
ctttctctgatggaccgtggctttgtgttcattttgatcaaaaactattgcaatcagctg
ggagccaaattgaattcagtgcctactgttattcccatgaggttggaattccttcggatc
ctctgcagtcatgaacattacttgaatcttaatctcttctttgtgaactcagcactatct
gccccagcatcaccatgtccatccatctcctcccagaactcaagctcttgctctagtttt
caggatcagaaaattgccaacatgtttgaccttactactgagtaccgccagcaacacttt
ctcactggactgctcttcagtgaactagctacagcattggaccaagagacagaaggaatt
gtaagagtacagaggaaagctatcaatgcagtacaaagcctgctgtgctctcatgaccta
gaccaacgctacataaaaccagaactgaaaactaaaatagctgccttgtacctccccctg
gttggaataattctagaagcactgccgcagctctgtgatttcacagtttcagatgctcga
aataaaggtcggccaagtagccaagatgaggaatcagaagccataaacccaatcaatcag
tctgttgctatggcaatagcaggaaatccactcagctcccttttaaaaaatactgtgtca
gctgctacaacactgcccagcaagcagtataatgctctgactgctgaaaccagtcgaaat
ctactgatttgttttctgtggattatgaagaacgccgaccacagccttattcagaagtgg
actgtggatctttctacaacccagctgaacaagatcttggagctgctttatatcggtgtt
tcttgttttgagtataaggggaagtcatcttcagataaagtcagtacacaggttctccag
aagtccagggatgcaaaggcacggctggaagaggctttgctgggaggtgcaggagcaagg
ggagaaatgatgaagcgctgcaggattccagcaggcaatgaaagattccagggggtcaat
gaaaacctaagatggaggaaagatcaaatgcagtggcggcagaataacgagaggctagat
aaaacgaaagctgagctggaccaagaagccctgattagcggaaacttggctacagaagct
aatttaatcattctagatatgctggaaactatcacacagggtattgctgcctcagattgc
aaagacaatgtactgggaggagtgtttcgagttctcttacattccctgagctgcaaccaa
agttccatctacttgaaacactgcttcagtacactcagagcactcatcattaagtttgga
gacctgctgtttgaagaggaggcagagcaatgtgcagacctatgccagcgagttctgcat
cactgcagtagttctatagacagcacccgtacccaggcctgtgccaccctctacatcatc
atgagatacagcttcagcaaccccagtaacttttcaagagttaaaatgcaagtcacaatg
tccctggcatccctggttggcaagtcttcagatttcaatgaggtgtacctgaggaagtct
ttaagaaccatcttagcttatggagaagaagatgaggaaatgcagcccacactcttccct
gttcaggtatatgaaatgctgtgtaacttgaacagcatcctgtcagatacagtgaaaatg
agggaattccaggaggatccagagatgcttatggacctcatgtacagaattgccaaaggg
tatcagacgtcacctgatctgcgcctaacctggctacagaacatggcagaaaaacatagt
acgcggaagtgctacacagaggcggctatgtgccttgtccatgcggcagcactggtggca
gaatatctgagcatgcttgaggaccacagctacctgcctgtcgggagtgtaagctttcag
aatatttcttctaacattttggaggagtcagcagtttctgatgacgtcttgtctcctgat
gaagatgggatttgttctgggaagtatttcactgaaagtggcctcgtaggattgctggag
caggcagctgaatgtttcagcgttgctggcttgtacgagactgtaaacgaggtctacaaa
gtagtcattcccattcttgaagctcatcgagattttcgaaaactgacctcaacgcatgat
aaactgaaaaaatccttcgacagcattataagcaagggtcataagcgaatgtttggaacc
tatttccgagttggtttctatggatcaaaattttgggacttggatgaacaggagtttatc
tataaggagcctactatcaccaagctaccagagatttcccaccggttagagggattttat
ggccagtgttttggagaggaatcagtggaggtgattaaagattccactcctgtggacaac
acaaaattagatccaagcaaggcatacatacaaattacttttgtggagccgtattttgat
gagtatgaaatgaaagacaggatcacctacttcgaaaagaattttaatctgcgtcgcttt
atgtatacaactccatttacccttgacggacgtccccggggagacctcaaggatcagtac
aagagaaagaccatcctaacgacaatgcatgcttttccatacatcaaaactaggatcaac
gtcatacaaaaggaagagtttattttgacccctatcgaagtagcgattgaggacatgcag
aagaagacactggagttggcagttgcaaccagtcaggaaccaccagatgccaagctgctt
cagatggtgctgcaagggtctgttggtgccactgttaatcagggaccactagaggtagcc
caagtatttctggctgagattccagtggacccaaaacttttccgacatcacaacaagttg
aggctatgcttcaaagagtttattatgcggtgtggagaagcagtggagaagaacaagcgc
ttgatcactgtggaccagaaggagtatcagcaggagctaaagaaaaattacaacaagctg
aaggagaatctcaggcccatgattgagcggaaaatcccggagctgtacaaacctattata
aaagtctgcagtgaaagaagtgattcctgtagatccagtttaagaagatatgaaactcag
tcttcagtcccacagaacagctga

DBGET integrated database retrieval system