KEGG   Latimeria chalumnae (coelacanth): 102352709Help
Entry
102352709         CDS       T02913                                 

Gene name
CACNA1I
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 I
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04010  MAPK signaling pathway
lcm04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102352709 (CACNA1I)
   04020 Calcium signaling pathway
    102352709 (CACNA1I)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lcm04040]
    102352709 (CACNA1I)
Ion channels [BR:lcm04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102352709 (CACNA1I)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans LRR_8 PKD_channel LRR_5 LRR_4 Casc1_N
Motif
Other DBs
NCBI-GeneID: 102352709
NCBI-ProteinID: XP_014350844
Position
Un
AA seq 2772 aa AA seqDB search
MLVILLNCVTLGMFQPCEDVDCSSERCKILQAFDDFIFIFFAMEMVVKMLALGIFGKKCY
LGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTVRVLRPLKAINRVPKLLQNFAQKLLE
HPQNFVPKLLELCTETSRTTQKLLERPEEFTQRLLELLQNFVQKLLETHSQFGDKGYVWL
AICSQNQPPYESIPQHINSTVQDLRLNENKLKVVLYSSLNRFSNLTDLNLTKNEIYYIED
GAFASQTMLQVLQLGYNKLTNLTEGMLRGLGRLQFLFVQHNLIDVISPTAFYECPSLINI
DLSSNRLAKLDSSTFVSLSALMVCELAGNPFHCSCELFGFLNWLLKFNNVTKNYDRLQCE
TPREFAGYPLLSPRPHHNWNAITIFQSRCRNGLMTSSPWPQPTDSTEGSGLTTEDLILPE
AMTLSTTDSSHNPSIELHRVTISSATLVVQIPLPFKKMYILVQYNNSYMSDVMNLKKHKE
YITLDKLKAETNYTFCVVSISKSQRYNHTCLSFGTKIKVPNGRGPDTSTTTHYIMTILGC
LFGMVIILGAVYYCLRKRRLQEEKQKSINVKKTILEMRYGPDTDTSSIVPSSQKLSEHSI
PVSCMSSIPSVVGDKGHCKSLDACETPKVTTKVNYIEVRTGEPSEQERERTQREREEDLS
YLDNGQGSAAEISTIAKEVDKVNQIINNCIDALKLDSASFLGAESEMVFECQPVPTSSSQ
QERPSFLSPSYKDSVHPLQRQLSADAAIKKRCSISSSGSIKSARVFSLDVPDPSSKVDSK
YIEKSSPTGGPLERLPLVSPGDVHHLEVKPSFHCSEHRHSFPALYYEENVDTMSQRASFL
KPLSRSKRDSSYSQLSPRHFSGYSSSPEYSSESTHKIWERFRPYKKHHPHEEVYMAAGHA
LRKKVQFAKDEDLHDILDYWKGVSAQQKFGGDDDDDVSDRLKLVPQKPAFTSGAETSKSL
ALATGVKLNKYMAWNCRRQYKEVGSFFMINLCLVVIATQFSETKQREHQLMQEQRARYLS
SSTVASFAEPGDCYEEIFQYVCHILRKARRRTAGLYSSLQTGHRRRTDRRLNVSKFISNG
RERRESRFSQHHSQLDISPHALVQPIVLTLSSDPANCPQCNSTQHSDSGSTGGSDTGSAH
SGPGAPQEPGKEAPGGDAGSEPGKSDEDEERKGFCVRLCDEVRCKLRGIVDSKYFNRGIM
MAILINTISMGIEHHQQPEELTNVLEISNIVFTSMFALEMLLKLTAFGLFTYLRNPYNIF
DGIIVIISVWEIIGQSDGGLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCM
LLMLFIFIFSILGMHIFGCKFSLKTDSGDTLPDRKNFDSLLWAIVTVFQILTQEDWNVVL
YNGMASTSPWAALYFVALMTFGNYVLFNLLVAILVEGFQAEGDANRSYSDEERSLSNFEE
GEKLKELQHPSDPKLCTSPMTPNGHLDPALPPSQLFAATVVTSSRGSLQPEQIHTMTGSR
KSSIISLRNSDMKSMSSGSHYGPWGCGSGWGSRRSSWNSLGCGSSLKQKMHSGEHESLLS
YEGHKAPMEERDEAKLERAPRMDSRLRRALSLDTKGSSELVQALPNQKRLRKNSTAPASS
DHQDCNGKTPNIASEIFPKMKAKKDKDDMDEEIDYSLCFRIQKMMEVYKPDWCEMREDWS
VYLFSPENRFRLLCQTIITHKLFDYVVLAFIFLNCITVALERPDIQQGSVERLFLTVSNY
IFTAIFVAEMTLKVVSLGFYIGDQAYLRSSWNILDGFLVFVSLIDIIVSLASAGGAKILG
VLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFK
GKFFFCLGPNVRNVTNRSDCLAANYKWIHHKYNFDNLGQALMSLFVLASKDGWVNIMYNG
LDAVAIDQQPIMNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEAKRR
EEKRLHRLEKKRRSKESPKPLVGSYCPARLFIHTVCTSHYLDIFITFIICLNVVTMSLEH
YNQPLSLEVALKYCNYMFTTVFVLEAVLKLIAFGLRRFFKDRWNQLDLAIVLLSVMGITL
EEIEINAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFML
LFFIYAALGVELFGKLVCDDDHPCEGMSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTL
RDCTSDDRSCLSNLQFISPLYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEDAELDA
EIELELAQGLCSQTPGPSCLGLDLGVGRGPLGKPGADKHLEPRRCFSPAQENLWLDSVSL
IIKESFEGELLMIDNLSGSVFHHYASPPTCGSATNHKQEIHLAETEAFSLTSDKSSSGAL
ADDLSLDDPSVYHFGSRETKDEQDSPESPGSEEMTESLLVTMESSEQPAGPVATESQLLE
IEEWPSDPAPCHTTIKEPAKTNTVASSQTSPDASSLQFPAEFFHPAMPSPRRGPEEDSTQ
SGLPKIPSRGSWASLRSPSINYPLHRQSAVSDTSLDSSSGESDGSLQTTLEESLNFSDSP
QCTLDLPMLCETPTSQRTQARASSVPQKQMAHSRQVFALQSTRGHQRSHSSGGSTSPGFT
HHDSMDPSDEEGVGGSLRANSEQSETLSSLSLSSLFSPSSLAPILVKKCSSTSSLDTIAR
SKDPQQFYTVDSQGFLSTPSWVSDFCRSVHPAGPEGGSDGSQKRDTELSPVTNRPAVHSG
PEYTSPSGKKNR
NT seq 8319 nt NT seq  +upstreamnt  +downstreamnt
atgctggtgatcctgttgaactgcgtcacgctggggatgttccaaccatgcgaagatgtg
gactgctcatcggagcgctgcaaaatattacaggcgtttgatgatttcatcttcattttc
tttgccatggagatggtcgttaagatgctggcccttgggatctttggcaagaagtgttac
cttggtgacacctggaaccggctggatttcttcattgtcatggcagggatggtagaatac
tccttggacctacagaacatcaacttatccgcaatacggaccgtccgggtcctccggccc
ttgaaagccatcaaccgcgtgcccaaacttctacagaactttgcacagaaacttctagaa
catccacagaactttgtgccaaaacttctagaactttgtacagaaacttctagaaccacg
cagaaactcctagaacgtccagaggaattcacacagagacttctagaacttcttcagaac
tttgtgcagaagcttctagaaactcacagccagtttggggacaagggctacgtgtggctg
gcgatatgcagccagaaccagcccccttacgagagcatcccacaacacatcaacagcacg
gtgcaagacctgcgcctcaatgagaacaagctgaaggtggtgctctactcttctctgaac
cgcttcagcaacctgacggacctgaacttgaccaagaacgagatctactatattgaggat
ggggccttcgccagccagaccatgcttcaggtgcttcagctgggctacaacaagctgacc
aatctcactgaaggcatgctcagaggcctgggcaggcttcagttcctgtttgtgcaacac
aacttgatcgacgtgatctccccaactgcgttctatgagtgcccgagcctcatcaatatt
gacctgtcatccaaccgcttggccaagctggacagtagtacgtttgtgagcctcagcgcc
ttgatggtttgtgaactggccggcaaccctttccattgcagctgtgagctctttgggttc
ctgaactggctgctgaagttcaacaacgtcaccaagaactatgaccgcctccagtgtgag
accccaagggagtttgccggctacccgctcctgagccccaggccgcaccacaactggaat
gccatcacgattttccagtcccggtgccgcaacggactaatgacttcatccccatggccc
cagccgacggattccactgaaggctcgggtttgaccactgaagacttgatcttaccggaa
gcaatgaccctgtctaccacggactcgtcccacaacccaagcattgagctgcatcgcgtc
acaatcagctctgccaccctggtggtccagatccccttgccctttaaaaagatgtacata
ttagtgcagtacaataatagctatatgtctgatgttatgaacctcaagaaacacaaggag
tacatcacactggacaagctgaaagctgaaacgaactataccttctgcgtggtctccata
agcaaatctcaaaggtataaccacacctgcttatcatttggcacgaagatcaaagttccg
aatggccgtgggcctgacacctctaccaccacgcactacattatgaccatcttgggctgc
ctgtttgggatggtgatcatcttgggggccgtgtattattgcctgcggaaacggaggctc
caggaggagaagcagaagtccatcaatgtgaagaagacaatcctggagatgaggtatggg
ccagacaccgacaccagctccattgtgccgtcttcccagaagctgagcgagcactccatc
cccgtctcatgcatgtcttcaataccctctgtagtgggtgacaaggggcattgcaagtct
cttgacgcatgcgagacgcccaaggtgacgaccaaggtcaactacattgaagtccgcaca
ggggagccttcggaacaggaaagggagcgaacacagagagagagggaagaagacctgtca
tacttggacaacgggcaggggtctgctgctgagatatccaccatagccaaggaggtggac
aaggtgaaccagatcatcaacaactgcatcgacgcgctgaagctggactctgcctcattt
ttgggcgccgagtccgaaatggtcttcgagtgccagcctgtcccaactagttcttcccag
caggagaggcccagcttcctctcaccttcctacaaggacagtgttcaccctctccagcgc
cagctcagcgcggatgcagccattaagaagcgctgcagcatctcgtccagtgggtccatc
aagagtgccagggtcttcagcctcgacgttcctgacccttcctcaaaggtggattcaaag
tacatcgagaaaagtagcccaactggcggtcctctggagcggcttcctttggtatctcct
ggagatgtgcaccacttggaggtcaagcctagcttccactgcagcgagcatcgtcactcc
ttcccagccttgtactatgaagaaaacgtggacaccatgagccagagggcctcctttctc
aaacccctttccagatccaagagagactccagctactcccagctctctccccggcatttc
tctggctactcttccagcccggaatactcctcggagagcactcacaaaatctgggagcgg
ttccgcccatacaaaaagcatcacccccacgaggaagtgtacatggcagccgggcacgcg
ctgaggaaaaaagtgcagttcgcgaaagacgaagacttgcatgacatcttagactactgg
aagggagtctcggctcaacagaaatttggtggtgatgatgatgatgatgtcagcgacaga
ctgaagcttgtgccccagaagccagccttcaccagtggtgccgagactagcaaatctctt
gccttggctacaggagtaaaactgaacaaatacatggcatggaactgcaggaggcaatac
aaggaggtagggtccttcttcatgatcaatctgtgcctggtcgtcatagcgactcagttc
tcggagacgaagcagcgggagcaccagctgatgcaggagcagcgggcccgctacctctcc
tccagcacggtggccagcttcgccgagccaggcgactgctacgaggagatcttccagtac
gtctgccacatcctgcgcaaagcccggcgccgcacggccggcctctacagcagcctgcag
actggccatcgccgccgcaccgaccgcaggctgaacgtcagcaagttcatcagcaacggc
agagagagaagagagtcacggttcagtcagcatcacagtcaattagacatctcgccgcac
gctctcgtacaacccatagtgctgaccctgtcgtctgatcctgccaactgcccgcagtgc
aacagcacccagcacagcgacagtggcagcactggcggctcagacacgggcagcgcccac
tccggccctggggcaccccaggagcccgggaaggaggcgccaggaggggacgcgggctca
gagccgggcaagtcggacgaggacgaggagaggaagggtttctgtgtgaggctttgcgat
gaggtccgctgtaagctgaggggcatcgtggacagcaagtacttcaaccgaggaatcatg
atggccattctcatcaacaccatcagcatgggcatcgaacaccatcagcagccggaagag
ttgaccaacgtcttggagatcagcaatattgtcttcaccagtatgtttgcgctggagatg
ctcctcaaactgaccgccttcgggctcttcacctaccttcgaaacccctacaacatcttc
gacggaatcatcgtgatcatcagtgtctgggagatcatcgggcagtctgatgggggtctc
tccgtcttgcggaccttccgtctcctgcgggtcctgaagctggtgcgcttcatgccagca
ttgcgccgtcagctggtggtcctgatgaagacaatggacaacgtggccaccttctgcatg
ctgcttatgctcttcatcttcatcttcagcatcctgggaatgcacatatttggctgtaag
tttagtctgaaaacagacagtggagacacactccccgacaggaagaatttcgactccttg
ctttgggctattgttacagtatttcagattctcactcaggaggactggaacgtcgtgctc
tataatggaatggcctccacatcaccttgggccgctctctactttgtggctctcatgacc
tttgggaactatgtgctctttaaccttctggtcgccatcttagtagaaggattccaggct
gagggagacgcgaacaggtcgtactcggatgaggagaggagcttgtccaactttgaggag
ggggaaaagttgaaggagctgcagcatccttcagatccaaagctatgcaccagccccatg
acccctaatggacacctggaccctgcactgcccccgagccagctctttgcagccacggtc
gtgacctcttcacggggctctctgcagccagagcagatccacacaatgactggatccaga
aaaagcagcatcatttccctgaggaattccgatatgaagtcaatgtctagtggttctcac
tacggcccctgggggtgcggaagtggctggggaagtcgccgttccagttggaacagcttg
ggctgtggctcaagcctcaagcagaagatgcactccggagaacatgagtccctgctgtcc
tacgagggccacaaggcaccaatggaagagagggatgaggccaagctggagagagctcct
aggatggactctaggctcaggcgggcactgtcactggacaccaaggggtcctccgagctt
gtgcaggccctgccgaatcagaagcgcctgaggaagaacagcaccgcgcctgcctcatcc
gaccaccaggactgcaatgggaagacgcccaacattgccagtgagatcttcccaaagatg
aaggccaagaaggacaaagacgacatggatgaggagattgactacagcctctgctttcgg
attcagaagatgatggaggtatacaagccagactggtgtgaaatgcgggaggactggtct
gtgtatttgttctcccccgagaacaggtttcgtcttctctgccagactatcatcactcac
aagctcttcgattatgtcgttctggcatttatttttctcaactgcatcacggttgcctta
gagaggcctgatatacagcagggaagtgtggaaagacttttcctcacagtgtccaactac
attttcactgccatctttgttgctgagatgacgctgaaggtggtctctttggggttttac
atcggagaccaggcctacctccgaagcagctggaacattcttgatggattcctggtcttt
gtgtctctgattgatatcatagtctcactggcttcagctggaggggcaaagattttggga
gtccttcgtgtcctgaggctgctacgcaccctgcgacctctacgagtgatcagccgagct
ccaggcctgaagttggtggtcgagacccttatctcctctctaaagcccatcggcaacatt
gtccttatctgctgtgctttcttcatcatcttcggcatcctcggagttcagcttttcaaa
gggaagtttttcttctgcctgggaccgaatgttcgcaatgtcaccaacagatccgactgc
ctggctgctaactacaagtggattcatcacaagtacaactttgataatctcggccaggcc
ttgatgtccttatttgttctggcttcgaaagatggctgggttaacattatgtacaatgga
ctggatgcagtggccattgatcaacagccaattatgaaccacaacccctggatgctcttg
tacttcatctcctttctgctgatcgtcagtttcttcgtgctcaacatgtttgtgggggtg
gtggtggagaacttccacaaatgccggcagcaccaggaggcagaggaggcaaaacgccgt
gaggagaagaggctgcaccgcctggagaaaaagcgcaggagtaaggaatctcctaaaccc
ttggttggttcttactgtccggcacggctcttcatccacaccgtctgcaccagccactac
ctggacatcttcatcaccttcatcatctgcctcaacgtggttaccatgtccctggagcac
tacaaccaaccgctgtctctggaggtggcgctgaagtattgtaactacatgttcaccacg
gtcttcgtcctcgaggcggtgctgaagcttatcgcctttggattgcgccgttttttcaag
gacaggtggaaccagctggacctggctattgtcctactgtccgtgatgggcatcaccctg
gaagagattgagatcaacgctgcccttcccatcaaccccaccatcatccgcatcatgagg
gtcctacggattgccagggtgcttaagcttctgaaaatggccacgggaatgagagcctta
ctggacaccgtagttcaagcgctacctcaggtggggaatctgggtctcctcttcatgctt
ctgtttttcatctatgcagcgcttggggttgagcttttcgggaaattggtttgtgatgat
gaccacccttgtgaggggatgagccgccatgccacatttgagaactttgggatggccttt
ctgacactcttccaagtctctaccggggacaactggaacggcatcatgaaggacacactg
cgtgattgcaccagcgatgaccggagctgcctgagcaaccttcagttcatctcacccctc
tactttgtcagcttcgtgctgactgctcagtttgtcctcatcaacgtggtggtggccgtc
ctcatgaagcacctggatgacagcaacaaggaggcgcaggaggacgccgagctggatgct
gagatcgagctggagctggcgcagggactctgctcccagaccccgggcccctcttgcctg
ggcctggaccttggggttggccggggcccactggggaaaccaggtgcagacaagcacctc
gagcctcggagatgcttctcacctgctcaggagaacctctggttggacagcgtctcatta
ataattaaggaatcctttgagggagagctgctcatgattgacaacctctctggctccgtt
ttccaccactatgcatctccgccgacctgtgggagcgccacgaaccacaagcaagagatc
catcttgctgaaacggaggctttctctctgacctcggataaatcgtcctcaggagctctg
gcagatgatctgagtctggacgatcccagcgtgtatcactttggcagccgggagactaag
gatgagcaggacagtccagaatccccaggctcggaggagatgacagaaagcctcctcgtg
accatggagagttcggagcagccagcggggcctgtggccacggagagtcagctgctggaa
atcgaggagtggccctcagacccagctccgtgccacactaccatcaaggaacctgcaaaa
accaacacagttgcttccagccagacatcccccgatgcttccagcttgcagtttccggct
gagttcttccacccagctatgccctctccaaggaggggccccgaggaggactccacccag
agcggtcttcccaagattccttcgcgtggatcttgggcctctctacgatcccccagcatc
aactatcctctccatagacaatctgctgtgagtgatacttccctggactcgagcagcggg
gagtccgacggcagcctccagacgacgttggaagagagcctcaacttcagcgactcaccc
cagtgcaccctggacctccccatgctctgcgagacacccacatcccaaagaacgcaggcc
cgagcctccagcgtcccacagaagcaaatggcccatagccggcaagtgtttgccctccag
agcactagggggcaccagcgcagccacagcagtggaggcagcaccagccctggctttacc
caccacgactccatggacccttcagacgaggaaggagtgggaggcagcttgagggccaac
agcgaacagtctgagacgctaagcagcctctccttgtcttctcttttctccccatcgtcc
ctggctcccatcctggtcaagaagtgtagcagcaccagtagcttggacaccatcgccagg
agcaaggacccccagcagttctacaccgttgactcgcagggcttcctctccaccccgtct
tgggtttcagacttctgtagaagcgtccatccggcagggcctgagggagggtcagatggc
agccaaaaacgagacactgagctaagccccgtgaccaacaggcccgccgtgcactcgggg
cccgagtatactagccccagtggcaagaaaaacagatga

DBGET integrated database retrieval system