KEGG   Latimeria chalumnae (coelacanth): 102353554Help
Entry
102353554         CDS       T02913                                 

Gene name
ATP1A1
Definition
(RefSeq) ATPase Na+/K+ transporting subunit alpha 1
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04260  Cardiac muscle contraction
lcm04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102353554 (ATP1A1)
   04261 Adrenergic signaling in cardiomyocytes
    102353554 (ATP1A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lcm04147]
    102353554 (ATP1A1)
Enzymes [BR:lcm01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     102353554 (ATP1A1)
Exosome [BR:lcm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102353554 (ATP1A1)
  Exosomal proteins of other body fluids (saliva and urine)
   102353554 (ATP1A1)
  Exosomal proteins of colorectal cancer cells
   102353554 (ATP1A1)
  Exosomal proteins of bladder cancer cells
   102353554 (ATP1A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Motif
Other DBs
NCBI-GeneID: 102353554
NCBI-ProteinID: XP_014347449
Ensembl: ENSLACG00000001454
Position
Un
AA seq 1021 aa AA seqDB search
MGKGTGRDKYELAATNEHGRKKGKNKERDMDELKKEVALDDHKLSLDEIQRKYGTDLTRG
LTTNRAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAAME
DEPVNDNLYLGVVLSTVVIVTGCFSYYQEAKSSKIMESFKNLVPQQALVVRNGEKLSINA
EGVVVGDLVEVKGGDRIPADLRIISAHGCKVDNSSLTGESEPQTRSPDFSNENPLETRNI
AFFSTNCVEGTARGVVINTGDNTVMGRIATLASGLEGGRTPIAIEIEHFIHIITGVAVFL
GVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLE
AVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGVSFDKSSATWAALA
RVAGLCNRAVFQAGQENTPILKREVAGDASESALLKSIELCCGSVREMRENNPKVAEIPF
NSTNKYQLSIHKNFDTKESRFLLVMKGAPERILDRCSTILIQGKEQELDEEMKDAFQNAY
LELGGLGERVLGFCHLALSDSQFPENYQFDTDEVNFPTEKLCFVGLISMIDPPRAAVPDA
VGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVNQVNPRDAKA
CVVHGSDLKDMSSEQLDDILKHHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDS
PALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTS
NIPEITPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPKTD
KLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPFSLIGIRVNWDDRWTNDLEDSY
GQQWTYEQRKIVEFTCHTSFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEET
ALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSLLIFVYDEIRKLILRRNPGGWVEKETY
Y
NT seq 3066 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaagggactggacgcgataagtatgagttggctgcaacgaatgaacatggaagg
aagaaggggaaaaacaaggaaagagatatggatgaactgaagaaagaagtggcattggat
gatcataagctctccttggatgaaattcaaaggaagtatggcactgacctgactcggggt
ttaacaaccaaccgtgctgctgagatcttggctcgggatggtccaaatgccctcacccct
cctcccaccaccccagaatgggtgaagttctgtagacagctctttggaggtttctccatc
cttctctggattggagctatcctttgtttcctggcctatggtatccaggctgctatggaa
gatgaaccagtcaatgataatttgtatcttggtgttgtcttgtcaactgttgtcatagtc
actggctgcttctcgtactaccaagaggctaagagctctaaaattatggaatcgtttaaa
aacttggtgccacagcaagcccttgtggtccgaaatggcgagaagctgagcatcaatgct
gagggagttgtagttggagatctagttgaggtgaaaggaggagaccgaatccccgctgac
ctccggatcatctctgcgcatggctgtaaggtggataactcttcgctcactggtgagtca
gagcctcagaccagatctcctgacttctctaatgagaaccccttggagaccaggaatatc
gctttcttctccacaaactgtgtggaaggtactgcccgtggtgttgtcataaacactggt
gataatacagtgatgggtcgtattgccactctagcatctggtctagaaggtggtcgcacg
ccaattgccattgaaattgaacacttcatccatatcatcactggggtggctgtcttcctt
ggagttagctttttcatcctttccctgatccttggttacacctggttagaggctgtcatc
ttcctcattggaatcattgttgctaatgtgccagaaggattgcttgctactgtcacagtc
tgtctgactttgactgctaaacgtatggctcgtaagaactgtttggtgaaaaacttggaa
gctgtggagacccttggctctacctccactatctgctctgataaaactggtaccctgacc
cagaacagaatgactgtggcccacatgtggtttgataaccagattcatgaagctgacacc
acagagaaccagtcgggtgtgtccttcgacaagagttcagctacctgggctgcactcgca
cgtgtagcagggctctgtaaccgggctgtgttccaggctgggcaggagaacacccccatt
ctcaagagagaggttgcaggtgatgcttctgaatctgccctgttgaagagcatagagctg
tgctgtggatcagtcagagagatgagagagaacaatcccaaagtagcagaaattcctttt
aattccactaacaagtaccagctttccatccacaagaactttgacaccaaagagtcccgc
ttcctactggtaatgaagggtgctcctgagagaattctagatcgctgttccaccatcttg
atccagggtaaagagcaggagctagatgaagaaatgaaggatgccttccagaatgcttac
ctggaactgggtggactgggagaacgagtgctgggtttctgccatcttgccctatctgat
agccagttccctgaaaattaccagtttgacacagacgaggtgaacttccctacagagaag
ctgtgttttgtggggttgatctccatgattgacccaccccgagctgctgtacctgatgct
gttggcaagtgcaggagtgctgggattaaggttatcatggttaccggtgatcatccaatc
acagccaaagccattgcaaagggtgttggaatcatttctgagggtaatgagaccgtggaa
gacatcgcagctcgactcaacatcccagtaaaccaggtgaatcccagagatgctaaagca
tgtgtggttcatggatcggacctaaaggacatgagcagtgagcagttggatgacattctg
aagcaccacactgagattgtgtttgctcggacctcccctcaacagaaactgatcattgtg
gagggctgccagagacagggtgctatagttgctgtaactggtgatggtgtgaatgactcg
ccagccctaaagaaagcagatattggtgttgctatgggcattgctgggtctgatgtctcc
aaacaagctgctgatatgatcctgctggatgataactttgcctccattgtaactggtgtg
gaagaaggtcgcttgatttttgacaatctgaagaagtccattgcctacaccttgaccagt
aatatccctgagattactccattcttattgttcatcattgcaaacatccccttgcctctg
ggaacagtcactatcctttgcattgacttgggaactgacatggttccagcaatctccctg
gcttatgaacaggctgagagtgacatcatgaaaagacaaccccgaaaccctaagactgat
aaattggtgaatgagaggttgatcagtatggcctatggacagattggaatgattcaggct
ctaggtggtttctttacttactttgtgatcctagctgagaatggattcctgcctttcagc
ttgataggaatccgtgttaactgggatgacaggtggaccaacgaccttgaagatagctat
ggacaacagtggacctatgagcagagaaagattgtggagttcacctgtcacacctccttc
tttgtcagcattgttgttgtgcaatgggctgatttgatcatctgtaaaaccagaaggaac
tccgtcttccagcaaggaatgaaaaacaagatcctgatatttggtctgtttgaagagact
gcacttgctgccttcctctcatactgccccggaatggatgtagctctgagaatgtacccg
ctgaaaccaagctggtggttctgtgctttcccatactccctcttaatctttgtttatgat
gaaatccgaaaactcatcctccgacgcaatccaggaggttgggtggagaaagaaacttac
tattaa

DBGET integrated database retrieval system