KEGG   Latimeria chalumnae (coelacanth): 102353708Help
Entry
102353708         CDS       T02913                                 

Definition
(RefSeq) probable arginine--tRNA ligase, mitochondrial
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    102353708
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lcm01007]
    102353708
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lcm03016]
    102353708
   03029 Mitochondrial biogenesis [BR:lcm03029]
    102353708
Enzymes [BR:lcm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     102353708
Amino acid related enzymes [BR:lcm01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   102353708
Transfer RNA biogenesis [BR:lcm03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    102353708
 Prokaryotic Type
   Other AARSs
    102353708
Mitochondrial biogenesis [BR:lcm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    102353708
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1d
Motif
Other DBs
NCBI-GeneID: 102353708
NCBI-ProteinID: XP_014339475
Position
Un
AA seq 156 aa AA seqDB search
RLGIQFDEYSGESIYQKKSQEVLKLLETQGLLKRTTRGTGVVDLSEHGDMSFYATVVRSD
GTALYLTRDLAAAIDRMNTHNFNKMIYVTDKSQQPHFQQVFQTLSIMGYPWAKSCQHVPF
GLVQGMSTRRGEVVFLEDVLDEVCSRMLQNMEASQI
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
cgcttaggcatacaatttgatgagtactctggggagtcgatttaccagaaaaaatcgcag
gaggtcttgaagttactggaaacacaagggctgctgaaaaggacaacgagaggaaccggt
gtagtggatctttcagaacatggagacatgtctttttacgccactgttgtacgtagtgac
gggacggcgctctacttaacgagagaccttgctgctgctatagaccgaatgaatacgcat
aattttaataaaatgatttatgtgacagataagagccagcagcctcatttccagcaggtg
tttcaaacgctgtcgatcatgggatacccatgggcaaaaagctgtcaacacgttcccttt
gggctggtccaggggatgagcactcgaagaggagaggttgtattcttggaagatgtttta
gatgaagtttgctcacggatgctgcagaatatggaggcttctcagatttga

DBGET integrated database retrieval system