KEGG   Latimeria chalumnae (coelacanth): 102354203Help
Entry
102354203         CDS       T02913                                 

Gene name
PRODH2
Definition
(RefSeq) proline dehydrogenase 2
  KO
K11394  hydroxyproline dehydrogenase [EC:1.5.5.3]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00330  Arginine and proline metabolism
lcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    102354203 (PRODH2)
Enzymes [BR:lcm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.3  hydroxyproline dehydrogenase
     102354203 (PRODH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_dh
Motif
Other DBs
NCBI-GeneID: 102354203
NCBI-ProteinID: XP_014352499
Position
Un
AA seq 415 aa AA seqDB search
MFLRGGVLRKELSALGSVPGGLHSFHRASSSTRDVLGSASPKSQLSFDDGRAFCLKTGWE
VIRGLLVFRMCSYPRLVNSSMKLMQFGRRVLGRRLFSAVMKASVYGQFVAGETLPEIQRS
MEKLKSLGIRPMLAVPIEEDLGEDKTGVLSLSPPPPSLSHYRPHPRNPLTKKLTTCLQEP
SAMKELKIEKVAKAMDSEELKFACLTEDENQHFLASLHRLRKIGQHAKDNKVRVLVDAEY
TYLNPALTLVTMAMMMKFNQSESWIWNTYQCYLKEAYNQATRDVELADKLGFCFGVKLVR
GAYMDKEQKRAREEGYKDPIQESWEATNKRMEELGIPKDGGGVCFGQLLGMCDHVSVTLG
QAGYAIYKSIPYGPLEDVMPYLVRRAQENQAVLKGIRKERDLLYRELKRRLLRRN
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgtttctgaggggaggtgttttgcgaaaggagctttcagctttaggatctgtccctggc
ggcttgcattctttccaccgggcctcctcgagcacccgggacgtgctggggtcagcctcc
cccaagagccaactcagcttcgacgatgggagagcattctgtctgaagacaggatgggag
gtcatccgggggctcctggtattccggatgtgttcctatcccaggctggttaacagttcc
atgaagttgatgcagtttggccggagagttttgggccgacgcctgttttcagcagtgatg
aaggcctcggtttatggccagtttgttgctggggagactctgccagagatccagcggtcc
atggagaagctgaagagcttgggaatccggcccatgctggcggtgcctatcgaggaggac
ctgggagaggacaaaactggagtgctgtctctgtcacctcctcctccatccctgtcacac
tatcgccctcaccctcgcaaccccctcacaaaaaagttaacaacatgcctgcaggagccc
tcagcaatgaaggagttaaagatagagaaagttgctaaagccatggacagtgaggagctg
aaattcgcttgtttgacggaagatgaaaaccagcatttcctcgcctcccttcaccggcta
aggaagatcggccagcacgcgaaggacaataaagttcgtgtcctggtggatgcggaatac
acttacctcaaccctgccctcactctggtaaccatggcaatgatgatgaaattcaaccaa
tcagaatcctggatttggaacacctatcagtgctacctgaaggaagcttacaaccaggcg
acccgggatgttgaactggctgataagctgggcttctgttttggggtaaagctcgtgcgg
ggggcgtacatggataaggagcagaagcgggccagagaggaggggtacaaggaccccatc
caggagagctgggaggcaacaaacaagaggatggaggagctgggaatccccaaagatgga
ggtggcgtgtgtttcggacagcttttggggatgtgtgaccatgtgtctgtgactcttggt
caagcaggctacgccatctataaatccatcccctacggccccttggaagacgtcatgccc
tacttagtccggagagctcaggaaaaccaggcagttctcaaggggatccggaaggagcgg
gatctgctgtatagggagctgaaaagacggcttctacgacggaactag

DBGET integrated database retrieval system