KEGG   Latimeria chalumnae (coelacanth): 102355337
Entry
102355337         CDS       T02913                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00230  Purine metabolism
lcm00240  Pyrimidine metabolism
lcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102355337
   00240 Pyrimidine metabolism
    102355337
Enzymes [BR:lcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     102355337
SSDB
Motif
Pfam: dNK AAA_33 AAA_18 AAA_28 Thymidylate_kin AAA_17
Other DBs
NCBI-GeneID: 102355337
NCBI-ProteinID: XP_006007935
Ensembl: ENSLACG00000003686
UniProt: H3A3C3
Position
Un
AA seq 270 aa
MATPPKRMCRSPVFDNSFEKRSRKVSIEGNIAAGKSTFVRMLEKASDEWEVIPEPIARWC
NVQTKEDEHEELTTSQKSGGNLLQMLYEKPTRWAYTFQTYACLSRVRAQLNPPAPKIREA
EHPVQFFERSVYSDKYVFASSLLESGDLSETEWAIYQDWHTWLLSKFEPQLELDGIIYLR
ATPEKCMDRLHARGREEEQGIELKYLEKLHYKHETWLHKRTMRMDFEYLKDLPVLVLDVN
EDFKNDRIKQEALLDKVYVHSSWGVYVKWL
NT seq 813 nt   +upstreamnt  +downstreamnt
atggccaccccgccgaagaggatgtgtaggagcccggtgttcgataacagtttcgagaag
aggagtcggaaagtttccattgaagggaatatcgctgcagggaaatcgacgtttgtgcgt
atgcttgagaaagccagtgatgagtgggaagttataccagagccgatagccaggtggtgc
aatgtccagaccaaggaggatgagcatgaggagttgaccacgtcccagaagagcggcgga
aacctgctccaaatgctgtacgagaagcccactcgctgggcttataccttccagacatat
gcctgtctaagcagagtgcgagcccagctcaaccctccagctcccaaaatacgggaagcg
gagcatccggtccagttcttcgaacgatcggtttacagtgacaagtatgtctttgcctca
agcttgttggagtcgggggacctgagtgaaacagagtgggcaatctaccaggactggcac
acgtggctcctcagtaagtttgagccacagcttgaactagatgggatcatctatctccgg
gccacacctgagaaatgtatggatcgtctgcatgcgagaggtcgcgaggaggagcagggg
attgagctgaagtacctggaaaagctacactacaaacacgaaacctggcttcacaagaga
accatgagaatggactttgaatacttgaaagaccttcctgttctggtgctcgacgtcaac
gaagacttcaagaatgatcggatcaaacaggaggctctcctggataaggtatatgtacac
agtagttggggtgtgtatgtcaagtggctgtaa

DBGET integrated database retrieval system