KEGG   Latimeria chalumnae (coelacanth): 102356030
Entry
102356030         CDS       T02913                                 

Definition
(RefSeq) N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming)-like
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
lcm  Latimeria chalumnae (coelacanth)
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102356030
Enzymes [BR:lcm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     102356030
SSDB
Motif
Pfam: AstE_AspA
Other DBs
NCBI-GeneID: 102356030
NCBI-ProteinID: XP_005999315
Ensembl: ENSLACG00000003417
UniProt: H3A2G8
Position
Un
AA seq 313 aa
MASQVSYRPLKRVTVAGGTHGNEMAGVFLVKHWLKDPSELRRASFAAEPFVSNPHAVKRC
VRYVDRDLNRCFTTEILTSKPSSDYIPYEIQRAKEINQLLGPKGSTVAVDFLIDMHNTTS
NMGNCFIFNFPQDYIAIHLVNYLQRNITSAPCRTFLSEASLDNSYSLDSVGQHNLSFELG
PQAQGVIRADILNRMRSLMKCALDFFQLFNQGTEFPPCEIEVYKILEKEDYPRDENGELS
AIIHPDRQDKDFEPLNFGDPVFQTFGGETITYKGEGTVYPVFINEAAYYEQKIAFWKTQK
TTLSAPGIQVQKE
NT seq 942 nt   +upstreamnt  +downstreamnt
atggcctcccaagtttcctaccgtcctctgaaacgtgtcacggtggctggtggtacccac
ggcaatgaaatggcgggggtcttcttggtgaaacactggctgaaggatccctctgagctg
cgccgggccagctttgctgccgaaccctttgtctcgaacccccacgccgtgaagcggtgc
gtgcgatatgtggatcgtgacttgaaccgctgcttcaccacggaaattttaacctcgaag
ccgtcatcggattatattccctacgagatccagagagcgaaagagatcaaccagctgctt
ggtccaaaagggagcactgtggctgttgacttcctcattgacatgcacaatactacctcc
aacatgggcaactgtttcattttcaattttccgcaggactatatagctatccacttggtc
aactacttacagcggaacattacctcagctccttgccgcaccttccttagtgaagcatcc
ttggataactcatattcactggattcagttggccaacacaacctgagttttgaactgggt
cctcaggctcagggtgtgatcagggcggacattttgaaccggatgcggtcactcatgaag
tgcgcccttgactttttccagctgtttaaccagggtacagagttccctccatgtgagata
gaggtgtataaaatcctagagaaagaggactacccgcgagacgagaatggagaactcagt
gctataattcacccagacaggcaggataaggattttgaacccttaaactttggggacccc
gttttccagacgtttggaggggagactatcacgtacaagggtgagggcactgtgtaccct
gtctttatcaacgaggcggcgtactatgagcaaaagattgccttttggaagacacagaag
acgacgctgtcggctccagggattcaggtccagaaggaataa

DBGET integrated database retrieval system