KEGG   Latimeria chalumnae (coelacanth): 102357196Help
Entry
102357196         CDS       T02913                                 

Gene name
TNF
Definition
(RefSeq) tumor necrosis factor
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04010  MAPK signaling pathway
lcm04060  Cytokine-cytokine receptor interaction
lcm04150  mTOR signaling pathway
lcm04210  Apoptosis
lcm04217  Necroptosis
lcm04350  TGF-beta signaling pathway
lcm04620  Toll-like receptor signaling pathway
lcm04621  NOD-like receptor signaling pathway
lcm04622  RIG-I-like receptor signaling pathway
lcm04625  C-type lectin receptor signaling pathway
lcm04920  Adipocytokine signaling pathway
lcm04933  AGE-RAGE signaling pathway in diabetic complications
lcm05132  Salmonella infection
lcm05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102357196 (TNF)
   04350 TGF-beta signaling pathway
    102357196 (TNF)
   04150 mTOR signaling pathway
    102357196 (TNF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102357196 (TNF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102357196 (TNF)
   04217 Necroptosis
    102357196 (TNF)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102357196 (TNF)
   04621 NOD-like receptor signaling pathway
    102357196 (TNF)
   04622 RIG-I-like receptor signaling pathway
    102357196 (TNF)
   04625 C-type lectin receptor signaling pathway
    102357196 (TNF)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102357196 (TNF)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102357196 (TNF)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102357196 (TNF)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102357196 (TNF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lcm04052]
    102357196 (TNF)
   00536 Glycosaminoglycan binding proteins [BR:lcm00536]
    102357196 (TNF)
Cytokines and growth factors [BR:lcm04052]
 Cytokines
  Tumor necrosis fators
   102357196 (TNF)
Glycosaminoglycan binding proteins [BR:lcm00536]
 Heparan sulfate / Haparin
  Cytokines
   102357196 (TNF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF DUF2140
Motif
Other DBs
NCBI-GeneID: 102357196
NCBI-ProteinID: XP_006007247
Position
Un
AA seq 237 aa AA seqDB search
MSTENMLCEFDKKGLIVLREEKRSSTAWRWISLLSFLLLIGAMALFAAMHFQQKPSTSTQ
TQNPEKSEQDQMPRITSENSSLPVFMKLKAMKSSKPAAHLEGIIENQKLVWHSDINHAFL
KDGMKLENNKLVVPSRGLYFIYSQVVFKGQGCNGPRSLSHAIYRYSQQYPVDKVLLSSSK
TVCEGNTHHDKPWLQPIYQGAVFDLEKDDVLSTETHPESNGDIDTEDGNTYFGAFAL
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagagaacatgctttgcgagttcgacaagaaagggctcatcgtcctgcgagag
gagaaacgctccagcacagcttggcggtggatcagcctactatctttcctgctgctcatc
ggagccatggcgctgtttgcagcgatgcacttccagcagaaaccttccaccagcacgcag
acacagaaccctgaaaagagtgaacaagaccagatgccacgcatcacctcagaaaactca
tctctccctgtatttatgaaactaaaagcaatgaagtcatccaagccagcagcacacctc
gaaggtatcattgaaaaccagaagctggtctggcacagtgacatcaaccacgccttcctc
aaggatggcatgaagctggagaacaacaagctggtggtcccaagccgtggcctgtatttc
atctactcccaggtggtcttcaaggggcagggctgcaatggcccacgtagcctcagccac
gccatctaccgctactcccaacagtaccccgtggacaaggtccttctcagctcctccaag
accgtctgtgaaggcaacacccaccacgacaagccctggttgcagcccatctaccagggc
gccgtcttcgacctggagaaggacgacgtcctctcgactgagacgcaccccgagagcaat
ggagacatcgacaccgaggacggcaacacctacttcggggcgttcgccttgtga

DBGET integrated database retrieval system