KEGG   Latimeria chalumnae (coelacanth): 102358043
Entry
102358043         CDS       T02913                                 

Gene name
MECOM
Definition
(RefSeq) MDS1 and EVI1 complex locus
  KO
K04462  ecotropic virus integration site 1 protein
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102358043 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lcm03000]
    102358043 (MECOM)
Transcription factors [BR:lcm03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    102358043 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_jaz zf-C2H2_6 zf-H2C2_5 zf-BED GAGA zf-C2H2_11 zf-Di19 zinc_ribbon_15 PyrI_C zf-C2H2_8
Other DBs
NCBI-GeneID: 102358043
NCBI-ProteinID: XP_014342011
Ensembl: ENSLACG00000017233
Position
Un
AA seq 1054 aa
MKSGDYPYQTMAPDIHEERQYRCEECDQLFESKAEFVDHQKFPCSTPHSVFSMVEEDFQQ
KLNSEQELQDMHEAQECRECDQVFSDAQSLDGHMLSHAEEREYKCDQCPKAFNWKSNLIR
HQMSHDSGKHYECENCSKQVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHK
HIHSSVKPFTCEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFC
EGKNHFTAGGLFGQGISLPGTPIDKTAMVNMNHTNPGLADYFGTNRHPPGLTFPAAPGFP
FHFPGLFPSGLYHRPPLISTSSPVKGLPASDQIGKSQNPLLTPPQMLSTTPDILKALSKQ
PAIGESKSLALQPEGSSEERPPGKTSDQSESSDLDDVSTPSGSDLETTSGSDLESDVESD
KEKYKENGKMFEDKINSPENLASVSNSKKEYANHSMFSPSLDEQTAVSGAVNDSIKAIAS
IAEKYFGSTGLVGLQDKKVRALPYPSMFPLPFFPAFSQPMYPFPDRDLRSLPLKMEPHSP
SEMKKIQSGSSESPFDLTTRRKEEKPVTSVTSKPVTSILSNNQDQPLDLSMGSRSRASVT
KHVEPRKNHVFGEKKGVELEQAKACDSSLQHARPTSFFMDPIYRVEKRKVTDPLELLKEK
YMRPASGFLFHPQFQLPDHTTWMSAIENMAEKLESLNSLKPESSELMRSVPSMFNFRAPP
SALPETLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQR
HVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNLCGTATSSPHSEIDNSSAVLDD
KEDSYFNEIRNFIGNSNHNNQSPGNSDERVNGNHFEEDKGMTTNQKSEELDRGEAEDEVI
LEEEDEEGSMTGKHVNEPALGNMDEVNPNEEDYEEPSNLELNCKSSPGRYKSDEGKSGLS
ALDHIRHFTDSLTLRKIEENQYTEAELAAFSTSHLADDIKQPLFRKSKSQAYAMMLSLSD
KDSIHSTSHPPPNIWQSMARAAVESSAIKSLSHV
NT seq 3165 nt   +upstreamnt  +downstreamnt
atgaagagtggagattatccatatcaaacgatggctccagacattcatgaggagcgtcag
taccgctgtgaagagtgcgaccagctgttcgagtccaaagccgaatttgtggaccatcag
aagttcccctgcagcactccacactctgtgttctccatggtggaggaagacttccaacag
aaactcaacagtgaacaagagttacaagacatgcatgaggctcaggagtgtagagagtgt
gatcaagtgttttcagatgcacaaagtttggatggacacatgctgtcccacgctgaggag
agagaatacaagtgtgaccagtgcccgaaggcttttaactggaagtctaacctgattcgt
caccagatgtcacatgacagtggaaagcactacgaatgtgaaaactgttccaagcaggtt
ttcactgaccccagcaacctgcagaggcacattcgctctcaacatgtgggagcacgggcg
cacgcgtgcccagagtgcgggaagaccttcgccacttcttcaggactcaagcagcacaag
catatccacagcagtgtgaaacccttcacctgtgaagtctgccacaaatcctacacccag
ttttctaacctctgtcgacataaacgtatgcacgccgactgtagaacccaaatcaaatgc
aaagactgcgggcaaatgttcagcactacatcatctctaaacaaacacaggcgattttgt
gaaggcaagaaccattttaccgcagggggattatttggccaaggtatttcactacctggc
accccaatagataaaactgctatggttaacatgaatcacactaatcctggtcttgccgat
tactttggcacgaataggcaccctcctggattgacgttcccagcagcccctgggtttcct
tttcattttcctggcctgtttccttcaggcttgtatcacagaccacctttgatatccacg
tcttctcctgttaaaggactaccagctagtgaccagatcggcaaaagccaaaatcccctt
ttgacgcctccccagatgttatccacaactccagatattttaaaagcgttgagtaagcag
ccagccataggtgaatctaaatcactggcgctccagccagagggatcctctgaagagagg
ccacctggaaaaacaagtgaccagtccgagagcagtgacctcgatgacgtcagcacaccg
agcggcagtgacctggaaacgacctctggctctgacttggaaagtgacgttgagagtgac
aaggagaaatataaggaaaatggcaaaatgtttgaagacaaaatcaacagtcctgaaaat
ttggcttcagtgagcaacagcaagaaggagtacgccaaccattccatgttctcaccatct
ttggatgaacaaactgcggtgtcaggagccgtgaacgattccataaaggccatagcttcc
atagctgagaaatacttcggttccacaggactagtaggattgcaggacaaaaaagtaaga
gctttaccgtacccttccatgtttccccttccgtttttcccagctttttctcagccaatg
tacccattccctgacagagacttgaggtctttacctctaaaaatggagccccattcaccc
agtgaaatgaagaagatccagagtgggagctctgagtctccttttgacctcacaacaagg
cggaaggaggagaagccagtgacctctgtgacctcaaagccagtgacttccatcctgtcc
aacaaccaggaccagcctctagatctgagcatgggcagtcggagccgagccagcgtcacg
aagcatgtggagcctcgtaaaaatcacgtttttggtgaaaagaagggagtcgagctggaa
caggcaaaggcatgcgactcttcgctgcagcatgccaggccgacatcgttcttcatggat
cctatctacagggtagaaaaaaggaaagtaacagatcctcttgaactcttaaaggagaag
tacatgaggcctgcttcaggtttcctgtttcatccacagttccaattgcctgatcataca
acctggatgtctgcgattgaaaacatggccgagaagctcgagagcctcaactccctcaag
ccggaaagcagcgagctgatgcgatcggttccctccatgttcaacttcagagcccctccg
agtgccctccccgagaccctcctgagaaagggcaaggagcgctatacctgcagatactgc
gggaagatttttccaagatctgcaaatctgactcgtcatctgaggacacacactggagag
caaccatacaggtgcaagtattgcgatcgctcctttagcatttcctccaatttgcaacgg
cacgttcgcaacattcacaacaaggagaaaccgttcaaatgtcacttgtgcgacaggtgt
ttcggacagcagacgaacttggacaggcatctaaaaaagcatgagaacgggaatctgtgt
ggtactgcaacatcttcacctcattctgaaatagacaacagtagtgcagttctggatgac
aaagaggattcctattttaatgaaattcggaatttcattgggaacagcaatcataataat
cagtcacccggaaactcagatgagagagtaaatggcaaccattttgaggaagacaaagga
atgacaaccaatcagaagtcagaggagttggatcgtggggaggcagaggatgaggtgata
ctggaggaggaggatgaagaaggcagcatgacaggaaaacacgttaatgaacctgccttg
ggaaacatggacgaagtaaaccccaacgaagaggattacgaagagccaagcaacttggag
ttaaactgcaagtcttctcctggaaggtacaaaagtgatgagggtaaaagtggactttct
gccctggatcacatcaggcacttcacagacagtcttaccttgaggaaaattgaggaaaat
cagtacactgaggccgaactggcagcctttagcacttctcatctggccgatgatataaaa
cagccattgttcagaaagtcgaagtcgcaagcatatgccatgatgctttctctttctgac
aaggactctatccactcgacatctcaccctccccctaacatatggcagagcatggcaaga
gctgctgtagaatccagtgccatcaagtctttgagccacgtatga

DBGET integrated database retrieval system