KEGG   Latimeria chalumnae (coelacanth): 102358088Help
Entry
102358088         CDS       T02913                                 

Definition
(RefSeq) guanylate cyclase soluble subunit beta-2-like
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00230  Purine metabolism
lcm01100  Metabolic pathways
lcm04270  Vascular smooth muscle contraction
lcm04540  Gap junction
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102358088
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102358088
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102358088
Enzymes [BR:lcm01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     102358088
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOB HNOBA
Motif
Other DBs
NCBI-GeneID: 102358088
NCBI-ProteinID: XP_014350261
Ensembl: ENSLACG00000009582
Position
Un
AA seq 744 aa AA seqDB search
MFLFLAFRLQYGFINTCLKSLVIDKFGEEMWEKLRAQAEVQDTFMTYQVYDDVITLRLVH
EACRMLNVSAEAVLKLFGEYFFNFCKVSGYDRMLRTLGGNLMEFIENLDALHSYLALSYQ
KMNAPSFRVERTADGTMLLHYYSDRRGLCHIVPGIIEAVAKDFFHSEVHMEILNQSEEVE
RTGKKEHVVFLVNQKATEQKRKLKQGTTTQDIDPPKTKEELEGALQKMKQKYSAIPRCSV
KKSHWEIIRSIVKFGQGNLLNSFEPVYPERLWVEEKIFCNAFPFHIVFDETLRIKQAGVN
IQKLVPGLQTLGVQVDDYFTMVHPQVTFTISSIRKFINSQFVLKTRREMMSESRKNKPML
QIRGQMIWMESIRCMIYLCSPKLRSLAELEERKMHISDIAQHDTTRDLILLNQQRLAEIE
LSNQLERKKEELRILSKNLEIEKKKTETLLYAMLPKHVANQLKEGKKVEAGEFQECTILF
SDVVTFTNICAACEPIQIVNMLNTMYSKFDRITNIHDVYKVETIGDAYMVVGGIPVPVTS
HAERVCNFALGMRIAAKEVMNPITGNPIQIRVGIHTGPVLAGVVGEKMPRYCLFGDTVNT
ASRMESHGIPNKIHLSPSAFRTIQNKGFETEERGEIEVKGKGKMTTYFLIKNLHATEDEI
MGRSVGLLSQSNEENNDKVEKADHNVKNIENQESKNAIVMKYADDHQFEEADHPTSGNQN
LIAKENAICLKFIFFLATAKTAPE
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgtttctctttctggctttccgtttgcagtatggatttatcaacacttgcctcaaatcc
ctcgttatagataaatttggcgaagaaatgtgggaaaagttacgagcacaagctgaagtt
caggacaccttcatgacttaccaagtttatgatgacgttatcactctacgacttgtccat
gaggcctgcagaatgctaaatgtttctgctgaagctgtgctgaagctatttggagaatat
ttcttcaatttttgtaaggtatctggatatgacagaatgttacggacacttggaggaaat
ttaatggaatttattgaaaacttagatgccctacacagttatcttgcactgtcttaccag
aaaatgaatgcaccatcatttcgagtagaaaggacagcagatgggaccatgttacttcac
tactattctgacagaagaggactctgccatattgttccaggtataatagaagctgttgca
aaagacttttttcacagtgaagtacatatggaaatcctgaatcaatctgaggaagtagaa
cgcacagggaagaaggaacatgttgtttttcttgttaaccaaaaggcaacagagcaaaag
aggaaactaaaacaaggtacaaccacccaggatattgacccccccaaaactaaagaggaa
ctagaaggagccctacaaaaaatgaaacagaaatactcagcaataccacgctgttcagta
aagaagtcccactgggaaatcataagaagtattgtaaaatttggacaagggaatttgctg
aactcctttgaaccagtttaccctgagagactttgggttgaagagaaaatcttctgcaat
gcctttccttttcacattgtgtttgatgaaacactaaggataaagcaggcaggagtgaac
attcagaagcttgttccaggattgcagacattgggcgttcaggtagatgactatttcacc
atggttcatccacaagtgacttttactatctccagcatacggaagtttatcaacagccag
tttgtactgaagacacggagagagatgatgtctgaatccaggaaaaacaaaccaatgctt
caaataagaggacaaatgatctggatggagtcaatacgatgcatgatatacttgtgttct
ccaaagcttcgcagcttagcggagctagaagaaagaaaaatgcacatttcggacattgca
cagcatgatacaactcgagaccttatcctcctgaaccagcagagactagctgagatcgag
ctttccaatcagcttgagagaaagaaagaagaactcaggatcctctccaagaatctggaa
atagaaaagaagaagacagagaccttgctgtatgccatgctgcctaaacatgtagcaaat
cagcttaaagagggcaagaaggtagaagcaggggaatttcaggaatgtactatcctcttc
agtgacgttgtgacatttactaatatatgtgcagcttgtgagcctattcaaatagtgaac
atgttgaacacaatgtactccaaatttgatcgaataacgaacattcatgatgtttacaaa
gttgagactattggtgatgcatacatggttgtaggaggaattccagtgcctgtcacaagc
catgcagaacgagtatgcaattttgctttgggtatgaggatagctgcaaaagaagtgatg
aatcccattacaggaaacccaattcagatcagggttggaatacatactgggccagttctg
gctggagtagttggagaaaagatgcccaggtactgtttgttcggagacactgtcaacaca
gcatcaaggatggagagccatgggattccaaacaaaatacatctgagcccatctgcattc
agaaccatacaaaacaaaggctttgaaacagaagaaagaggtgaaattgaggtaaaaggc
aaagggaaaatgactacatactttctgatcaagaacctacatgcaactgaggatgaaatc
atgggcagatcagtagggctgttatctcagtctaatgaagaaaacaatgataaagtagaa
aaggctgatcacaatgtgaaaaacatagaaaaccaagaatccaagaatgccattgtaatg
aaatatgctgatgaccatcaatttgaagaagctgaccacccaacttctggtaatcaaaac
cttatagcaaaagagaatgccatctgtctcaagttcattttcttcctggctactgccaaa
actgctccagaataa

DBGET integrated database retrieval system