KEGG   Latimeria chalumnae (coelacanth): 102358623Help
Entry
102358623         CDS       T02913                                 

Gene name
MAPK7
Definition
(RefSeq) mitogen-activated protein kinase 7
  KO
K04464  mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04010  MAPK signaling pathway
lcm04540  Gap junction
lcm04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102358623 (MAPK7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102358623 (MAPK7)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102358623 (MAPK7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lcm01001]
    102358623 (MAPK7)
Enzymes [BR:lcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102358623 (MAPK7)
Protein kinases [BR:lcm01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102358623 (MAPK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like Kdo MEF2_binding
Motif
Other DBs
NCBI-GeneID: 102358623
NCBI-ProteinID: XP_014349945
Position
Un
AA seq 1090 aa AA seqDB search
MAAPHKEEEQGKREAAQAMAAKNLAFLKARSLDVAFEVGDEYEIIETIGTGAYGVVSSAR
RRSTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDILKPSVPNSEFKSV
YVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYIHSANVIHRDLKPSNLLINEN
CELKIGDFGMARGLCTKPDEYKYFMTEYVATRWYRAPELMLSLHKYTQAIDMWSVGCIFA
EMLGRKQLFPGKNYIHQLQLIMTVLGTPSNEVIHSIGADRVRAYIQSLPSRQPVPWETLY
QGADKKALGLLAKMLRFDPKDRISVLDALKHPFLSKYHDPDDEPNCVPAFDFDFDKQVLT
KEQIKEAIIREINDFHEKREGIRRQISFKPFLRPAGAPHADTELLDIQQLVSLASGRDGL
LVANGDAMRVSSKAPDASAGIPKGERGLEPCCDVDMPSANSVSERMDFALDSSSRFAQPE
TIDLTSPMETVAKPPAQEEDTGRKPEGPAVKTEPEVVPKKEGAISDDTKAALKAAILKSA
LRNKNKDAVITSLETPDVRKPVTAQERQREREEKRKRRQERAKEREKKQKEKERKEMKKD
DTFGGLKLTENDKNLLERWKKMRDETSQPPQNGPGTGETNGGQVTVPPSHNITQPVFSVQ
NAHGPGTLAPSTRVEPGQPQKELILVNGAVGMMHPQPVAQETAVAFLGFPEKIGAANQNI
TLLPIVGEQKTTTAIAAVSQALVPNPSASAGVVHYYPAQPGAFPIGAPNSVLVAAPAHPD
GALAKGDCLMTSSHINMAPDMGVKYTPGQVFQPVFGVAPMNSWRGVTSQVEGGQSLVLQT
QGQVAPCQDSWPVSNPVPTQISQHPPHPTERSPQNRTGYIAPQDGRTGQNPVSLPSTSTI
NLGNYSQKGPGFSGREGLSLEPSVFLQDLGPAQPKPTLEPSQNLTSIYAMGHASQSTGQK
APGMSQHPTVSISSSDTSNSNSPDINLVTQQLSKSQVEDLLPPVFSVTPKGSGAGYGVGF
DLEEFLNQSFDMVGENRESQGDSAPLSASLLADWLEVHRMNPADMESLQQELQLGSPMIL
SDIPDLRALE
NT seq 3273 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaccgcacaaggaagaggagcaggggaaacgggaagccgcacaggcaatggcg
gccaagaacctggccttcctgaaggcacggtccctcgatgtagcctttgaggtgggcgac
gaatacgagatcatcgagacaatcggcactggcgcctatggggtggtgtcgtcggcccgg
cgcaggtccacaggccaacaagttgctataaagaagattcccaacgccttcgacgtggtg
acgaatgccaagcgaaccctgcgggagctgaagatccttaaacactttaaacacgacaac
atcatcgccattaaagatatcttgaagcccagcgtcccgaactcagagttcaaatctgtg
tatgttgtgctggatcttatggaaagtgacctgcatcagattatccactcctctcagcca
ctgacgctggagcacgtccgctatttcttgtatcagctgctgcggggcctgaagtatatc
cactcagccaacgtgatccaccgggatctcaagccctccaacctgctgatcaacgagaac
tgcgagttgaagattggcgactttggcatggccaggggcctgtgcaccaagccggacgag
tacaagtacttcatgacagagtatgtggcgacgcgctggtatcgggcgccagagctcatg
ctgtcgctccacaaatacacgcaggccatcgacatgtggtcggtgggctgcatcttcgct
gagatgctgggccgcaagcagctcttcccgggcaagaactacatccaccagctgcagctg
atcatgacagtattggggacgccgtccaatgaggtgatccactccatcggggccgaccgg
gttcgggcgtacatccagagtttaccctcccgccagccggtcccctgggagaccctgtac
cagggagctgacaagaaagcgctgggactgttggccaagatgctgcgctttgaccccaag
gaccggatctcagtcctggatgccctcaagcacccgtttttgtccaagtaccacgatccc
gacgatgagcccaactgcgtgccggccttcgactttgattttgacaagcaggtgttgacc
aaggagcagatcaaagaggccatcatcagggagatcaacgacttccatgagaagagggaa
gggatccgccgtcagatcagcttcaagcccttcctccgacctgctggggcaccacatgct
gacaccgagttgttggacatacagcagctagtctccctggcctctgggagggatggactc
ttggttgccaatggagatgccatgagggtgtccagcaaagcacccgatgcttctgctggg
attccaaagggtgaacgaggcctggagccctgctgcgatgtggacatgcccagcgccaac
tcggtgagcgagcggatggactttgccctggactcgtcctcccggtttgcccagcctgag
actattgatttgacgtcgcccatggagactgtggcgaagccacctgcccaagaagaggac
accgggaggaagccagaagggcctgctgtgaagactgaaccagaggtggtgccgaagaag
gaaggggccatctcagatgacacaaaggctgctctcaaagccgccatattaaaatcagcc
cttcgtaacaagaataaagacgcagttattaccagccttgaaacaccagatgtccggaag
ccggtgacggctcaggagcgccagcgagagcgggaagagaaacggaagcgacgacaagag
agagcgaaggagcgggagaagaagcagaaggaaaaagagcgcaaggagatgaagaaggat
gacacctttggcggactgaagctgacggagaacgacaaaaatctgctggagcgctggaag
aaaatgagggatgaaaccagccagccgccacagaatggccctgggacaggcgagacgaat
ggcggccaggtcacagtgccgcccagccacaacataacgcagccagtattcagcgtccag
aatgcccatggccctggcacattggcacccagtacccgagtggagccagggcagccacag
aaagagctcatcttggtcaatggagcggtgggcatgatgcacccacagcccgtggcacag
gaaacggcagttgcattccttgggttcccggagaaaattggggcagccaaccagaacatc
acgctgttgccgattgtgggggagcaaaagactaccacggcaatcgccgcggtgtcgcaa
gcactcgtgccaaaccccagtgcctctgccggtgtggtgcattattacccggctcagcca
ggggcttttcccattggggcccccaattctgtgctggtggcagcaccagcgcacccggat
ggtgcccttgctaaaggagactgcttgatgacctctagccacatcaacatggcgcctgac
atgggggtcaagtacaccccaggtcaagttttccagcctgtgtttggagtggctcccatg
aactcttggagaggtgtgactagccaagtggagggtggccagagtttagttttacagaca
caaggtcaggttgccccatgtcaagacagctggccagtaagcaatcctgtacccactcaa
atctcgcagcatcccccacatcctacagagaggtctccccagaataggacaggttacatt
gctccacaagatggtaggacagggcagaacccagtttcgttgccttccaccagcaccatt
aatctaggcaactattcacagaaaggcccaggcttcagtggacgggaaggcctcagtctc
gagccctcagtgtttctacaggatttaggaccagctcagccaaaaccgacactagagcca
tctcaaaacctgaccagtatttacgcaatgggacatgcatcccagtcaacggggcagaaa
gccccaggaatgagccagcatccaacagtgtccatctcatcctcggatacctctaactca
aattctcccgacatcaaccttgtgacccaacagctttcaaaatcccaggtggaggacctg
ctgccccctgtcttctcggtcacccccaagggtagcggagccggctatggagtgggcttc
gacctggaggagttcctcaatcagtccttcgatatggtcggagaaaacagagaaagccaa
ggtgactcggcccccctgtctgcgtccctgcttgctgattggctggaggtgcaccgcatg
aacccggctgacatggagtctctgcagcaggaactgcagctgggctctcccatgatcctc
tctgatatccccgaccttcgggccctcgagtga

DBGET integrated database retrieval system