KEGG   Latimeria chalumnae (coelacanth): 102358777
Entry
102358777         CDS       T02913                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
lcm  Latimeria chalumnae (coelacanth)
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:lcm03021]
    102358777 (AFF3)
Transcription machinery [BR:lcm03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     102358777 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int BRD4_CDT
Other DBs
NCBI-GeneID: 102358777
NCBI-ProteinID: XP_014347140
Position
Un
AA seq 1261 aa
MDIFDTDFLQEWDLDSLCVYEQDRNVLRRKERERRNQEAHQNDDTFKTGFPLFSEPYKTN
KGDELSSRIQNTLGNYDEMKDFLTDRSNQSHLVGIPKSGIPQTPVEKIDQQFFVDSQSQV
NPSNSSASSSASASFLAQRGKKATMSWPTTGRSTNDHQRKSKHGRRTLDSTSSDYKVEHQ
RSVDESNKTSGSSPTTSSSISGHNSYRATTGDTSNKQQQPSRFHCSQELASQTQDKQSLG
TKQNSSVHTVQNFPPSLTSKPNAVQQKPTAYVRPMDGQDQTPDESPKLKLSVEPTVHCSN
QTYGGITDNKPHTAGTKSKITKLTIPQLGEVTATGNNSCVEEILKEMTHSWPPPLTAIHT
PGKAEQSKFSFPAKDTQHVSSGYDQKRGNTEAKSPASNVPQTSMLLQASLPVFALLSHNW
SKISSGMLEDDLKLSSDEEENDQQASQKSVLGIISDSAPVQQSNGRGSGHSSEGSSSSSG
SESSSESDSESESTSSESDGSKPSQCSSPEPEQPSSNKWQLDKWLNKVNPHKSAVLNQND
SQGMNSSRSQSQITCEAEECEKTPALCQVDPKDKDSKSPSREEQRPRTANKALGNKGGKQ
KLLTVSETAPPKRPACKKQPRRSERTSSGDNPNCQKAEDLSTGKETLEPSALEHPKSRPQ
GGRAGHKKEPRPAPPCEKRRGKGQNKTVPKSKEFIETESSSSSSASSDLGSDSEREQPPP
AKLPVASSLATSNHKPKDCVSNGVNRVSNCSAVSSVNTRTTTEVANDLEEQLYTLVPFGR
NELVSPLKDNEELKSLWVKIDLTLLSRVPVHLPKEAFTGNAELKGVAGRHGNDIPSLSKE
KVPSRPRRKRKCENEDVCGDIKKNHTEKESSTAFIASADSTTNINDISLQVNKNEKRLMS
PLSPLSDTSDHKHFNSDFSSTGRQNSSNGFLPISNCRNHKTENKSQPQMKDLVTTSHINP
ENPHLCSKHHQPQGEPWSTMTNGHRECRRPKLFFDDMPRGVDYYMQEAKQMKHKADAMVE
KFGKAVNYTDAALSFIECGNAMEQGPMEAKSPYTMYSETVELIRYAMRLKTHSGPNATQE
DKQMAALCYRCLALLYWRMFRLKRDHAVKYSKALIDYFKQSKGLVLVTQNSVKAAQVPSP
WGANGKSTGTPSPMSPTPSPVSSVGSQGSVSSTTTPSPSSVISIPQRIHQMAANHVNITN
SILYSYDYWEMADNLVKENREFFNDLDALMGPITLHSSMTHLVQYTRQGLHWVRISAHLP
H
NT seq 3786 nt   +upstreamnt  +downstreamnt
atggacatcttcgacaccgatttccttcaggaatgggacttggactctttatgcgtctat
gaacaagacagaaatgtattacgacgaaaagaacgggaaagacgaaaccaagaggcccac
cagaatgatgacacctttaaaacaggcttccccttattcagtgagccatataagactaac
aaaggtgatgaactctcaagccgcatccagaacacacttggaaactatgatgaaatgaaa
gactttttgacagatcggtccaatcaaagccatcttgttggtattccaaaatctgggata
ccacagactcctgtggagaaaatagatcaacagttctttgtagactcgcaatctcaagtt
aatccatctaacagcagtgcttcttcatctgcttcagccagttttcttgctcagcgaggt
aaaaaggccacaatgagttggccaacaactgggcgaagcacaaatgaccaccagaggaaa
agcaaacatgggcgcaggacacttgactcaaccagcagtgattataaggttgaacaccag
agaagtgtagatgagtcaaataaaacaagtggatcaagcccaaccacatcatcttccata
tcaggacataattcttacagagctaccactggggacacttctaataagcaacagcaacct
tcaaggtttcattgcagtcaagaactggcatctcagactcaagacaagcaatcactagga
acaaaacaaaacagcagtgttcacactgttcaaaattttcctccctccctgacttccaag
ccaaatgcagtgcagcaaaagccaactgcttatgtacggcccatggatggtcaagaccag
accccagatgagtctcctaagctgaagttatcagtggagcctactgtgcattgtagtaac
caaacctatggaggaataacagataataagccacatacagccggtaccaagtccaagata
acaaaactgaccattccacagctaggggaggttactgcaactggtaacaacagttgtgtt
gaagaaattttaaaggagatgactcattcctggcctccaccattgactgctatacataca
cctgggaaagcggaacaaagcaagttttcatttccagctaaggacactcaacatgtcagt
tctggatacgatcaaaagagaggtaatactgaggcaaagagtccagctagcaatgtgcca
caaacatcaatgttactgcaagcaagtttgccagtctttgctttactaagccataactgg
agtaagatatcttcaggaatgctagaagacgacctaaagctaagcagtgatgaggaagaa
aatgaccagcaggcatcgcagaagtctgttcttggaatcatttctgacagtgctccagtg
cagcagtccaacggcagaggatcaggacattccagcgaaggatccagcagctccagtggg
tcagagagcagctcagagtccgactcggaaagtgaaagtacttctagtgaaagcgatggc
agcaagccttctcagtgttctagcccagagcctgagcaaccatcatctaataaatggcag
ctggataaatggctaaacaaagtaaatcctcacaagagcgcagttcttaaccaaaatgac
agccaaggaatgaacagcagccgatctcaaagccaaataacatgtgaagcagaagaatgc
gagaaaacccctgcactttgccaagtagatcctaaggacaaagatagtaaaagccccagc
agagaagagcagagaccaagaactgctaacaaagccctgggaaataagggtgggaaacag
aaactgcttactgtgagtgaaactgctcctccaaagaggccagcctgcaaaaagcaacct
agaaggtcagagaggacctctagtggtgataatccaaactgtcaaaaggcagaagacctt
tctacaggaaaggaaactttagaacctagtgcacttgaacatcccaaatccaggcctcaa
ggtggcagggcgggacacaaaaaagagccacgccctgcacctccctgtgaaaagaggagg
ggcaaagggcagaacaaaactgtaccaaaatccaaagagtttattgagactgaatcctct
tcatcttcatcagcttcatcagacttgggctcagactcagaacgagaacagcctccacca
gccaaattaccagtggcctcttccttggcaaccagtaaccacaaaccaaaagactgtgtc
agcaatggtgtcaacagagtgagcaattgtagtgctgtcagctcagtaaacacaaggact
actacagaggtagccaatgacttagaggaacaactctacacattagttccttttggtcga
aatgaacttgtttctcctctaaaagacaatgaggaactaaaatcactttgggtcaaaatt
gatttgacccttttgtccagagttcctgtacatctgcccaaagaagcattcacaggaaat
gctgaactgaaaggagtagcaggaaggcatgggaatgacatcccaagcctatcaaaagaa
aaggtaccatcaagacctagaagaaaacgcaagtgtgaaaacgaagatgtgtgtggtgac
attaagaagaatcacaccgagaaagagtcttcaactgctttcatcgcctctgctgacagc
accaccaacatcaatgacatatctttgcaggtaaataagaatgagaaaaggcttatgtca
cccctttcaccactgtctgatacatcagatcacaagcacttcaatagtgatttcagctct
actggtagacaaaacagcagtaatggtttcttacccatctccaactgcaggaaccacaaa
actgagaacaagtcgcagccacagatgaaagacctagtgacaacgtcgcatataaatccc
gaaaaccctcatctatgtagcaagcaccatcaaccacaaggagaaccttggtccaccatg
accaatgggcacagggaatgcagaagacccaagctcttttttgatgatatgccacgcggt
gtagattactacatgcaagaggcaaaacagatgaagcacaaggctgatgccatggtggag
aaatttggaaaggcagtaaattacacagatgcagcactgtcatttattgagtgtggaaac
gcaatggagcaaggccccatggaagccaaatctccttacacaatgtattcagaaacagta
gaacttatcaggtatgctatgagactgaagactcattcaggcccaaatgccactcaagaa
gacaaacagatggctgcattatgttatcgctgtttagcacttctctattggcggatgttt
cgccttaaaagggaccatgctgttaagtattccaaagcacttatcgactatttcaagcag
tctaaaggactcgttcttgtaacgcagaactctgttaaagctgcccaagtgccatctcca
tggggggccaatggaaagagcacaggaactccttcgcccatgtcacctacaccttctcca
gtcagctccgttgggtctcagggcagtgtgtccagcaccactaccccttccccatcatca
gtcatcagcattccacagcggattcaccagatggcggccaatcatgtcaatatcaccaac
agcattctctacagctacgattactgggagatggcagataaccttgtgaaggagaacaga
gaattctttaatgaccttgatgctttgatgggacccatcaccttacacagcagtatgaca
cacttggttcagtacacacgtcaaggactacattgggtacggatcagtgctcacctacca
cattga

DBGET integrated database retrieval system