KEGG   Latimeria chalumnae (coelacanth): 102359364Help
Entry
102359364         CDS       T02913                                 

Gene name
NMNAT2
Definition
(RefSeq) nicotinamide nucleotide adenylyltransferase 2
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00760  Nicotinate and nicotinamide metabolism
lcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    102359364 (NMNAT2)
Enzymes [BR:lcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     102359364 (NMNAT2)
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     102359364 (NMNAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 102359364
NCBI-ProteinID: XP_006008026
Position
Un
AA seq 307 aa AA seqDB search
MTETTKTHVILLSCGSFNPITKGHIHMFEKARDYLHKTGRFIVIGGIISPVHDSYGKQGL
VSSRHRLTMCQLAVHSSDWIRVDPWECYQETWQTTCSVLEHHRDLMKRVTGCILSNVNTP
STTPVIGQPQNGTRPIYQNGTIQNNKPTAVKFLGKVGESLGRICCVRPHMDRFTFVDENA
NLGTAMRYEEIELRILLLCGSDLLESFCIPGLWNECDMEVIVGDFGIVVVPRDGADTERI
MNHSSVLRKYKDNIIVVKDDMNHPMSIVSSTKSRLALQHGDGHVVDYLSQPVIDYILQNQ
LYINTSG
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagaccaccaaaacgcacgttattctgctgtcctgtggcagctttaaccccatc
accaagggccacattcatatgtttgaaaaagcccgtgattacctgcacaagacagggagg
ttcattgtgattggtggaatcatctccccagttcatgactcctatgggaaacagggtctg
gtctccagcagacatcgcctgaccatgtgccagctggcggtccactcgtccgactggatc
agggtggacccctgggaatgttaccaggagacctggcagaccacttgcagtgtgctggag
caccaccgggacctcatgaagagggtgacaggctgcatcctatcaaacgtgaacactccc
tcaacaactcctgtgattggacaaccacagaatggaacccgccccatctaccagaacggc
actatccaaaacaacaaacccactgcagtgaagttcctggggaaggtgggggaaagtctg
ggaaggatctgttgtgttcgacctcacatggatcgcttcacttttgtggatgaaaatgcc
aacttggggacagcaatgcggtatgaggagattgaactgcgtatcctgctgctgtgtgga
agtgacctgctagaatccttttgtattccaggcctctggaacgaatgtgacatggaagta
atagtcggggactttgggatagtggtggtgccacgagatggtgctgacacagaaaggatt
atgaaccattcctcagtacttcgcaaatataaggataacatcattgttgtaaaagatgac
atgaatcatccaatgtccatcgtcagttccaccaagagcagactcgccctgcagcatgga
gatggacatgtggtggattacctctctcagccagtcattgactacatcctgcaaaaccag
ctctacatcaacacttctggataa

DBGET integrated database retrieval system