KEGG   Latimeria chalumnae (coelacanth): 102359843Help
Entry
102359843         CDS       T02913                                 

Definition
(RefSeq) soluble guanylate cyclase 88E-like
  KO
K01769  guanylate cyclase, other [EC:4.6.1.2]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00230  Purine metabolism
lcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102359843
Enzymes [BR:lcm01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     102359843
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HNOBA Guanylate_cyc HNOB KLRAQ
Motif
Other DBs
NCBI-GeneID: 102359843
NCBI-ProteinID: XP_005992460
Ensembl: ENSLACG00000015710
Position
Un
AA seq 707 aa AA seqDB search
MYGLLCESLHDFIKESYGDDVWKLVRERADVRLHSFVTHQVYSESVIPQIAKAASGVTGT
PYNELMNSWGVYFLGFVGKYGYDRILKVLGRHVRDFINGLDNLHEYLRFSYPKVQPPTFF
CQEESATGVTLHYRSKRKGYLHYAMGQLRQMGKQFYDCDIHVEVLSEQLVGDYSHVTMRL
NFDNSAYRYIQKEDEEEQEILPITSDFFFEIFPFNIVFRQDMVVHNVGSGLATVFPDLDG
KKINDTFLLARPLVEFTWNMIISHPNNLFEIMSKEPVKRERNLHNRHDLLSSTMESWGDG
SRCLKLKGQMRFMPEWESIIFLGTPVMESLSAMFKTGLYINDLSMHDSSRDLVLAGTQQS
EELKRALIQEQKKSSKLEESMKMLDYEMKKTDDLLYRMIPKPVAKRLRKGEPAVNTCEVF
PDVTILFSDVVGFTRICSHITPMQVVSMLNTMYTLFDTLSEKHHVFKVETIGDAYMVVAG
APEKTKYHAHNICDMALDMVRSIDHLKDPFTGNNIQIRVGIHSGMVVAGVVGHKMPRYGL
YGDTVHTASAMESNGKEMHIQLSNATYEHLKGSHFIFEHRGTITIKGNVEIETYWLKGKR
DKDRNAQAACPQFETQTVSKSALSPPDFPVDEDESVYPSIIGDEEDVKSLRSDHIKIDNS
KISLVESMGESGIEEQSANKSHYKEFLADNGLQEVAGIHVENPRLKE
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgtatgggctcctgtgtgagagtttgcatgattttatcaaggaatcctatggggatgat
gtctggaagctggttcgtgaaagagctgatgttagacttcattcttttgttactcatcag
gtttacagtgaaagtgtaatacctcaaattgcaaaggctgcaagtggagtgactggtaca
ccttataatgagttaatgaactcctggggtgtatatttccttggatttgtaggaaagtat
ggatatgacagaattctaaaggtgctgggcagacatgtgcgagactttataaatggatta
gacaatctgcatgagtaccttcggttcagttaccctaaggttcagccgcccacctttttc
tgtcaggaggaatcagccactggggtaactctgcattacaggagtaagcgtaaagggtac
ctgcactatgctatgggccagctgagacagatgggaaaacaattctatgactgtgatata
catgtagaagttctatcagagcagcttgttggagactactctcatgtcaccatgaggtta
aactttgataactcagcttatcgctatattcaaaaggaggatgaagaagagcaggaaatt
ctgccaataaccagtgacttcttttttgaaattttcccatttaacattgtctttagacag
gacatggttgtacataatgtaggatcaggattagccactgtttttcctgatttagacgga
aagaagattaatgataccttcctgctagctcgtccattggttgagttcacctggaacatg
attatttctcaccccaacaacttatttgaaataatgtccaaggagccggtaaagagagaa
aggaatctacataaccgtcatgatcttctctccagtacaatggagagctggggcgatggg
agtcgttgcttaaagttgaaaggacagatgagattcatgcctgagtgggagtcaattatc
tttcttggtacaccagtcatggagagccttagtgccatgtttaaaactggattatatatc
aatgaccttagcatgcatgattcaagcagggatttagtgctggcaggaacacagcaatca
gaagagctcaaacgagctctaatacaggaacaaaaaaaatccagcaaactagaagaaagt
atgaagatgctggactatgagatgaaaaagacagatgacttactttacagaatgattccc
aaaccagtggcaaagaggctaaggaaaggtgaaccagctgtaaatacatgtgaggtcttc
ccagatgtcacaatcctgttcagtgatgtagttggattcaccaggatatgcagccatatc
accccaatgcaagtggtctctatgttaaacaccatgtacacactgtttgatactttaagt
gagaaacatcatgtcttcaaggtggagacaataggtgatgcatacatggttgtggctggt
gcaccagagaaaacaaaatatcatgcacacaacatttgtgatatggccctagacatggtt
cgctctattgatcatctcaaagaccctttcacaggaaataacatccagattcgagttgga
atacattctggcatggtagtggctggtgtggtaggacataaaatgcctcgttatggactg
tatggagacacagttcacactgcttcagctatggaaagtaatggaaaggaaatgcatatt
cagttgagtaatgctacctatgaacaccttaaaggaagccattttatatttgaacatcga
gggactatcacaattaagggtaatgtggaaattgaaacctattggctaaagggtaagcga
gataaagacaggaatgcacaagctgcttgtccacagtttgagacccaaactgtcagcaag
agtgccttatcacctccagatttccctgttgatgaagatgaatcagtctacccatcaata
ataggggatgaggaagatgtgaagtcactgcgttctgaccacatcaagatagacaactca
aagatttcactagtggaatcaatgggagaaagtggtattgaggaacaatcagcaaataag
tctcattacaaagaatttcttgcagataatgggctacaggaggttgctggcattcatgtt
gaaaatcccaggctcaaggagtga

DBGET integrated database retrieval system