KEGG   Latimeria chalumnae (coelacanth): 102360855Help
Entry
102360855         CDS       T02913                                 

Gene name
MARS
Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00450  Selenocompound metabolism
lcm00970  Aminoacyl-tRNA biosynthesis
lcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    102360855 (MARS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    102360855 (MARS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lcm01007]
    102360855 (MARS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lcm03016]
    102360855 (MARS)
Enzymes [BR:lcm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     102360855 (MARS)
Amino acid related enzymes [BR:lcm01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   102360855 (MARS)
Transfer RNA biogenesis [BR:lcm03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    102360855 (MARS)
 Prokaryotic type
   Other AARSs
    102360855 (MARS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g GST_N_5 WHEP-TRS tRNA-synt_1 Anticodon_1 GST_N GST_C GST_C_3 GST_N_3 GST_C_2 tRNA-synt_1e GST_N_2 GST_C_6
Motif
Other DBs
NCBI-GeneID: 102360855
NCBI-ProteinID: XP_005986254
Ensembl: ENSLACG00000018854
Position
Un
AA seq 904 aa AA seqDB search
MKLYLGEGSPGSLKALAAVEVTGVRVQLQFVSLEEHVVPYLTQPKVPALHLDGGNVLFSA
NAICQYLFTLTGKDQCDLTNQWLEWEATELEPAVLAVLYSAMVQGKSKEEGLGVLRKLLI
HVNQSLLKTSNPYLAGNSVSAADIVLWGSLYPLLSASVSLTEEFKTLNCWLQNLSSSEPC
QKAADAALKDAHLLKVYLQKLPVPAPLSQKPTCNEPEEEASTEHAFSEEEVAAAFQAWLK
GREASPKPRQFQHPILPEKNQKNILITSALPYVNNVPHLGNIIGCVLSADVFARYCRLRN
WNILYICGTDEYGTATETKAMEEGLTPQQICDKYNAIHSQIYQWFNISFDYFGRTTTHQQ
TEIAQDIFRRLLDRNFLLNDVVEQLKCEACNRFLADRFVEGVCPLCNYEEARGDQCDKCG
KLINAIELKKPVCKICKATPVVQSSQHLFLDLPKLEGTLEKWLEQSWATGDWTANARYIT
RSWIRDGLKPRCITRDLKWGTPVPLKEFEDKVFYVWFDAPIGYLSITACYTDQWEKWWKN
PEQVQLYQFMAKDNVPFHSVVFPCSQLGAEDNYTLVNHLIATEYLNYEDGKFSKSRGVGV
FGDMAKDTGIPADIWRFYLLFIRPEGQDSAFSWNDLLLKNNSELLNNLGNFINRAGMFVC
KFFEGRVPEMELNAEDKRLIAQVTWELQQSNQFLEKVRIRDALKCILNISRHGNQYIQVN
EPWKRIKGDDADQKRAGTVTGVAVNVACLLSVMLQPYMPSVSATIQEQLQAPQDCNVLTN
QFLCTLPAGHRIGMVSPLFQKLENDQIESLRRRFSGQQPKDEKKATEVKPGAAEVEKGGD
LERSKELTQEVEKQGNLIRELKMQKAEKALIDAEVEKLLELKKQLTLAEGKTPEAPAQKG
KKKK
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgtatttgggtgaagggagtcccggcagtttgaaggctcttgcagctgtggag
gtgacaggtgtgagggtacagttgcagtttgtgagtttggaagagcatgtggtgccttac
ctgacgcagcccaaagttccagccttgcacctagatggtggaaacgttctcttctctgct
aatgcaatctgtcagtacctgttcactttgactggaaaggaccagtgtgatttgaccaat
cagtggctggaatgggaggctaccgagctggagcctgctgtattggcagtgctgtattct
gcaatggtgcaggggaagagcaaggaggagggtctgggagtcctccggaaactactgatc
catgtcaatcagagcctgctgaaaacctccaatccctacttggcgggtaattcagtttca
gctgctgacattgtcctgtgggggtcgctgtatccccttctttcagcctcagtctcatta
actgaggagtttaagactctaaattgctggttgcagaacctgagttcctccgagccgtgc
cagaaagccgcagatgctgccctgaaggatgcccatctgttaaaagtttacctgcagaag
ctgccggtcccagccccgctgtctcagaaacccacctgcaacgagccggaggaggaagcc
tccactgaacatgctttctcagaggaggaggtagcagctgcattccaggcttggttgaaa
gggagagaagcttcacccaaacctcggcaattccagcacccaatattgcctgagaaaaac
cagaagaatattctcatcaccagcgccctcccctacgtcaacaatgtgcctcacctcggc
aacatcattggttgtgtgctcagtgctgacgtcttcgcccggtactgtcgcctaagaaac
tggaacatcctgtacatttgcggaacggacgagtacggcacagccacagaaaccaaagcc
atggaggaggggctgactcctcagcagatctgtgacaaatacaacgctatccacagtcag
atctaccagtggtttaatatctcctttgactactttgggagaacaaccacgcaccaacaa
acggagatcgcccaggatatcttcaggcgtttgctggaccggaacttcttgctaaatgat
gtcgtggaacagctgaaatgcgaagcatgcaatcgattcctggcggaccgctttgtggag
ggggtgtgtcctctctgtaactatgaggaagcccggggcgatcagtgtgacaaatgtggg
aaactcatcaatgccatcgagttgaagaaaccagtgtgtaagatctgcaaagccactcct
gttgtccagtcatcgcaacacttattcctggacctcccaaaactggaaggtaccctggag
aagtggttagaacagtcttgggccacaggggactggacggccaacgcccggtatatcact
cgatcctggatccgtgacgggctcaaacctcgctgcatcactcgagacttgaagtggggg
acgcctgtcccgttaaaggagtttgaagacaaggtcttctatgtgtggtttgacgctccc
attggttacctgtccatcaccgcttgttacaccgaccagtgggagaaatggtggaagaac
ccggaacaggttcagctgtatcagtttatggctaaggataacgtgccattccacagtgtc
gtctttccctgttcgcaacttggggcagaagacaactacactctggtcaatcacctcata
gcaacagagtacctgaactacgaggacgggaagttctccaagagccgaggggtgggggtc
ttcggtgacatggccaaggacacgggaatccccgcagatatctggcgattttacctactg
ttcatccgccctgaggggcaggacagcgccttttcgtggaacgacctcttattaaaaaat
aactcggagttgctgaacaacctgggcaatttcattaacagagccggcatgttcgtttgc
aaattctttgagggccgcgtgccagagatggagctgaacgcagaggacaagaggctgata
gctcaggtcacttgggagttgcagcaatccaaccagttcctggaaaaagtcaggatccgt
gatgctctgaaatgtatcctgaacatttctcgccatggtaaccagtacatccaggttaat
gagccgtggaaacggatcaaaggagatgacgcagatcagaagcgtgctggcacggtgact
ggcgtggcggtcaacgtcgcctgcctcctctcggtcatgctgcagccatacatgccctcc
gtgagcgccaccatccaggagcagctccaggctccacaggactgcaacgtcctgaccaac
cagtttctgtgcaccctccctgcaggccacagaattggcatggttagtcctctgtttcag
aagctggagaacgaccagattgaatcgctgagacgacgtttcagtggacagcagcctaaa
gacgagaagaaagcaactgaggtaaaacccggggctgcagaagtggagaaaggaggtgat
ctggagaggtctaaggagctgacacaggaggtggaaaaacaagggaacctcattcgggag
ctgaagatgcaaaaggcagagaaggcgcttattgacgctgaagttgaaaagttgctggag
ctgaaaaagcaactcaccctggctgagggaaagacccccgaggcccccgcccagaaggga
aagaaaaagaaatga

DBGET integrated database retrieval system