KEGG   Latimeria chalumnae (coelacanth): 102360987Help
Entry
102360987         CDS       T02913                                 

Gene name
CFB
Definition
(RefSeq) complement factor B
  KO
K01335  complement factor B [EC:3.4.21.47]
Organism
lcm  Latimeria chalumnae (coelacanth)
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lcm01002]
    102360987 (CFB)
Enzymes [BR:lcm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.47  alternative-complement-pathway C3/C5 convertase
     102360987 (CFB)
Peptidases and inhibitors [BR:lcm01002]
 Serine peptidases
  Family S1: chymotrypsin family
   102360987 (CFB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin VWA Sushi VWA_2 DUF1986 Trypsin_2 HRM
Motif
Other DBs
NCBI-GeneID: 102360987
NCBI-ProteinID: XP_006013281
Ensembl: ENSLACG00000003478
UniProt: H3A2N2
Position
Un
AA seq 764 aa AA seqDB search
MFSLFTVSFLLILLNLTVSLPSSNLQVQNKQCDEKDIAIEGGNFTLSYGFEIGSTLKYIC
PAGMVPFPLQVRECKHSGRWTPLTAPSGSTVSKSSCKPIKCPRPVEFEFGQYYPRFASYN
VGDTLEFECFEGYSLRGSSSRTCQMNGKWNGTTTICDSGSGHCHNPGIPLGASKVGTQYR
INDKVKYKCEGGLILVGSSERTCLESTDWTGTEPLCRVKYTFDTPEEAALFFGASLSAVM
ATENLDDKENLGRKLKLEKGGKVHLYILIDASSSVGEKEFKKATHCADQLIKRIASYDVV
PKFGIIAFATIPQHIIRMSDDASDDIDEVLSELENRKYEDLTDHGTGTNIDAALDEVLKM
MLFLRERNKAEFELVRHLVVLLSDGKANMGGSPERTIVKIQDLLGIGKNKDIPRDDYLDI
YTFGVGADIDEIELNNLASKKDGERHSFLLETYKDLEELFDQIVDEENTASMCGLAKQNK
KADGQQRNPWLVSIETRRDGKVHNCKGTLISAQWVLTAAHCFTIQDKSHLVNIWVGGKLV
SVSNLTLHDKYNINKKKAEGIEEFYDYDVALVKLKKKLLLGDDVRAMCIPCTEATNWALR
KPRVGTTCKDHAAELLSVGLTEAFFVTEGKEKDELDRKLVRIKTTGDHKRLCNEDAKKAE
FYVNVTDVSKVVTDRFLCTGGTEPQVDPNTCKGDSGGPIIISKKMRYVQVAVISWGVKDT
CKIQKSFTYARDFHLNLFKVIPWLQEHLKDEEFKFIPLGNIASD
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgttttctctgttcactgtcagctttctgctcatccttctcaacctcacagtttctctg
ccaagctcaaaccttcaagtgcagaacaaacagtgcgatgagaaggatattgcaatcgag
ggagggaatttcaccctgtcctatggctttgaaattggaagtacgttgaaatacatctgc
ccagctgggatggtgccctttccgctacaagtccgggagtgcaagcattctggcaggtgg
accccactaacggcaccctcagggagcacggtctcgaagtcttcctgcaagccaataaag
tgtcccaggccggtggagttcgagttcggtcaatattacccccggttcgcttcctacaac
gtcggcgacacccttgagtttgagtgctttgaaggatactcactgcgcgggtcatccagc
cggacctgccagatgaacgggaaatggaatgggacaaccaccatctgtgacagcggcagc
gggcactgccacaaccccggtatccctttgggtgcaagcaaggtggggacccagtatcgg
atcaatgacaaggtcaagtacaaatgcgagggaggcctcatactggtggggtcgtccgag
aggacctgcttggagtccacagattggacaggcaccgagccactctgtagagtgaaatac
acttttgacacgcctgaggaagcggccttgttttttggtgcttctttgtctgctgtcatg
gcaacagagaatttagatgacaaagaaaacttaggtcggaaactgaagctggagaaggga
ggaaaagttcatctctacatccttattgatgcctccagtagtgtcggcgagaaggagttc
aaaaaagccacccactgtgcagatcagctaattaaacggatagcgagttatgatgttgtc
cccaaatttggaatcatagcatttgcaaccattccgcagcacattattaggatgtctgat
gacgccagcgatgacattgatgaggtgttgagtgaacttgagaacagaaaatatgaagat
ctaacggatcacgggacggggacgaacatagacgcggccctggacgaggtgttgaaaatg
atgctgttcttacgggagagaaacaaggccgaattcgaactagtacgacacctggttgta
ctcctgtcagacggtaaagccaacatgggcggaagccctgaaagaactattgtaaaaatt
caggacctccttggcatcggcaaaaataaggatatccccagagacgattacctcgatatc
tacacctttggcgtcggagctgacattgacgagattgaattgaataacctggcttctaag
aaagacggagaacgtcactccttcctcctagaaacctataaagaccttgaggaactgttt
gatcagatagttgacgaggagaacacagcgagcatgtgcggcctagcgaaacagaacaag
aaggcggacggtcagcaaagaaacccctggcttgtctccatcgagacgaggcgtgacggt
aaggtgcacaattgtaaaggcacgctgatctccgcccagtgggtcctgactgccgctcac
tgctttaccattcaagacaaatcccatctggtcaacatctgggttggtggcaaactagtg
tccgtatccaatctgacactccacgacaaatacaacatcaacaagaagaaagcggaggga
attgaagagttttacgactacgacgtcgctctggtgaagctcaaaaagaagttactgttg
ggggacgatgtcagggcaatgtgtatcccctgcactgaagccacaaactgggcgttacgg
aaaccgagggtggggacgacctgcaaagaccatgcagcggaacttttgtcagtgggattg
acggaggccttttttgtaactgaggggaaggagaaggatgagttggacagaaagttggtt
cggatcaagacgactggagaccataaaaggctgtgcaatgaagacgctaagaaggcggag
ttctacgtcaacgtgacagacgtctcgaaggtggtgaccgaccgatttctctgcacgggg
ggcacggaaccacaagtggacccaaacacttgcaaaggagattctggcggtccgatcatt
atctcaaagaaaatgagatacgtccaggtggcggttattagctggggcgtgaaagacacc
tgcaaaatccagaagtcattcacctacgcccgggattttcacctgaatttgttcaaggtt
ataccttggctgcaggaacacttgaaggacgaggagttcaagttcattcccttgggaaac
atcgcttcagactga

DBGET integrated database retrieval system