KEGG   Latimeria chalumnae (coelacanth): 102361445Help
Entry
102361445         CDS       T02913                                 

Gene name
HSD17B8
Definition
(RefSeq) hydroxysteroid 17-beta dehydrogenase 8
  KO
K13370  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) / 3-oxoacyl-[acyl-carrier protein] reductase alpha subunit [EC:1.1.1.62 1.1.1.239]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00061  Fatty acid biosynthesis
lcm00140  Steroid hormone biosynthesis
lcm01100  Metabolic pathways
lcm01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    102361445 (HSD17B8)
   00140 Steroid hormone biosynthesis
    102361445 (HSD17B8)
Enzymes [BR:lcm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     102361445 (HSD17B8)
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     102361445 (HSD17B8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR 3Beta_HSD Polysacc_synt_2 Epimerase GDP_Man_Dehyd
Motif
Other DBs
NCBI-GeneID: 102361445
NCBI-ProteinID: XP_014346905
Ensembl: ENSLACG00000012715
Position
Un
AA seq 255 aa AA seqDB search
MAAPLRLVSRLALVTGGGSGIGHAVCQKLAREGAAVAVVDVIEAAAHETMRTLPCDHPEQ
QHEAFCADISSSEGVKQLLEGVQMKYSRPACIVVNCAGIIMDEFLLKMEEEDFDRVLAVN
LKGTFLITRGFSNALIASGAKKGSIINLGSIVGKVGNLGQANYAASKAGVEGLTKTAAKE
LARFGIRCNTVAPGFIATPMTDKVPKKVLEKIEKVIPLGRLGDPEDVAEACAFLASDDSS
YITGTSLEITGGLFL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcccttgagattggtgtccaggctggctctggttacaggcgggggcagcgga
atcgggcatgcggtgtgccagaagctcgccagggaaggcgctgcagtggccgttgttgat
gtcattgaggcagcggcccatgaaacgatgagaacgttgccatgtgaccacccagaacag
caacatgaggccttctgcgcggatatctcctcctcagaaggagtcaagcaactcctggag
ggagtacagatgaagtattcccgcccagcgtgcatcgtcgtgaactgcgccgggattatc
atggatgagtttcttctcaagatggaggaggaggactttgaccgggtcttagccgttaac
ttaaagggtacgttcttgatcactcgtggcttctccaatgctctgattgctagtggcgcc
aagaagggttccatcatcaacctgggcagcatcgtgggcaaggtggggaacttgggacaa
gccaactacgcagcctctaaagccggagtggagggactcaccaaaaccgcggcgaaggaa
ttagccaggttcgggatccggtgtaatactgtcgctccagggtttatagccaccccgatg
acagataaggtccctaagaaagtacttgagaagattgaaaaggtgattccattgggacga
ctgggagacccagaagatgtggctgaggcctgcgccttccttgcctccgacgacagcagt
tacatcacaggcaccagccttgagattacaggtggacttttcctgtag

DBGET integrated database retrieval system