KEGG   Latimeria chalumnae (coelacanth): 102361952Help
Entry
102361952         CDS       T02913                                 

Definition
(RefSeq) 5-beta-cholestane-3-alpha,7-alpha-diol 12-alpha-hydroxylase-like
  KO
K07431  sterol 12-alpha-hydroxylase [EC:1.14.18.8 1.14.14.139]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00120  Primary bile acid biosynthesis
lcm01100  Metabolic pathways
lcm03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    102361952
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102361952
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:lcm00199]
    102361952
Enzymes [BR:lcm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.139  5beta-cholestane-3alpha,7alpha-diol 12alpha-hydroxylase
     102361952
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.8  7alpha-hydroxycholest-4-en-3-one 12alpha-hydroxylase
     102361952
Cytochrome P450 [BR:lcm00199]
 Cytochrome P450, animal type
  CYP8 family
   102361952
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 Imm26
Motif
Other DBs
NCBI-GeneID: 102361952
NCBI-ProteinID: XP_006013942
Position
Un
AA seq 254 aa AA seqDB search
MAFLLPVLLAILLSVVGGLYLLGMFRQRRPKEPPLDKGWLPWLGHVLEFRRDTARFLKGM
QRKHGDIFTVQIAGYYFTFLMDPLSFGAVVKEARSKLDFNKFARELVVRVFGYHAMENEH
KHLQATSTKHLMGDGLVVMTQAMMENLQNLMLHELEIECGVKAWKQEGLFYFSYNIVFRA
GYLALFGNEPIKARGSTDKAKEFDRVHSEELFHEFRKYDRLFPRLAYAVLPPKDKLEAER
LKRLFWNMVSIREM
NT seq 764 nt NT seq  +upstreamnt  +downstreamnt
atggcttttcttcttccagtccttctggctattctactttctgtcgttggtggtctctat
ctgttggggatgttccgtcagagacgcccaaaagagccacccctggataaaggttggctg
ccgtggttgggacacgtgctggagttcagaagagatacagcaagattcctgaagggtatg
cagagaaagcatggtgacatctttacggtacaaattgctggatactatttcaccttcctt
atggacccactttcttttggggcagtggtgaaagaagccaggtctaagctggactttaac
aaatttgccagggaactggtggtcagggtctttggctaccatgccatggagaatgagcac
aagcacctgcaggctacaagcacaaagcatctgatgggtgatggactggtggtcatgacc
caggccatgatggaaaacttacagaacctgatgcttcatgagctggagatagaatgcggt
gttaaggcatggaagcaagaaggtcttttctattttagctacaatattgtctttagggct
ggctatctggcactgtttggcaatgagcccattaaagcaagagggagcacagacaaagca
aaagagtttgaccgtgtccattctgaggagctcttccatgagttccgcaagtatgaccgt
ctcttcccacgactggcctatgctgtgctgcccccaaaggacaagctggaggctgagaga
ttgaagaggttgttctggaacatggtctccattagggagatgag

DBGET integrated database retrieval system