KEGG   Latimeria chalumnae (coelacanth): 102363165Help
Entry
102363165         CDS       T02913                                 

Gene name
OXTR
Definition
(RefSeq) oxytocin receptor
  KO
K04229  oxytocin receptor
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04020  Calcium signaling pathway
lcm04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    102363165 (OXTR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102363165 (OXTR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lcm04030]
    102363165 (OXTR)
G protein-coupled receptors [BR:lcm04030]
 Rhodopsin family
  Peptide
   Oxytocin
    102363165 (OXTR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 102363165
NCBI-ProteinID: XP_005988002
Ensembl: ENSLACG00000018362
Position
Un
AA seq 393 aa AA seqDB search
MEGMYMTNTEVWLLNSSWGNASFENGTRNRNGTDPLVRNEEVAKVEVAVLSLILFLALTG
NICVLLAIHTTSHKKSRMYFFMKHLSIADLVVAIFQVLPQLIWDITFRFYGPDFLCRLVK
YLQVVGMFASTYMLLLMSIDRCVAICQPLRSLHQRSDRVYVFFSWFISLFFSIPQVHIFS
LKEVGAGVYDCWAGFIEPWGLKAYVTWITLTVYIVPVVILSVCYGLIVFKIWQNVKLKTR
QETHVNVASKSSREAVFSRVSSVKLISKAKIRTVKMTFVIVLAYILCWTPFFFVQMWSVW
DPKPPREAFAYVIAMLLASLNSCCNPWIYMFFTGHLFQDLVQRFLCCSAQYLKSRQHGCD
ISVSRKSNSSTFALSLKSSSSQKSITQTSMTQN
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaatgtatatgacaaatactgaagtctggcttttgaatagctcttggggtaat
gcaagcttcgaaaacgggactcgtaataggaatggcactgaccccttggtcaggaatgaa
gaagtggccaaagtagaggttgctgtgctgtccctcatcctgttccttgccctaactggc
aacatatgtgtccttttggccatccacaccactagtcataaaaaatcaagaatgtacttc
tttatgaaacacctcagcattgcagatcttgtggtggccatctttcaggtcttaccacaa
cttatctgggacatcacattcagattttatggacctgattttctttgtagacttgtcaaa
tacttgcaagtagtgggtatgtttgcttctacatacatgcttctccttatgtctatagac
aggtgtgtagctatctgccagcctttgagatctttgcatcaacgttcagaccgtgtctat
gttttcttttcatggttcatcagccttttcttcagcatcccccaagttcatatcttctcc
ttgaaagaggtaggggcaggggtttatgattgctgggcaggcttcattgaaccctgggga
ctaaaggcttatgtgacctggataacgttgacagtatacatcgttccagttgtgatctta
agtgtttgttatggcttaatcgtcttcaagatttggcaaaatgtgaaactaaagacaaga
caagaaacacatgtgaatgttgcttcaaaatcatcaagagaggcagtattctcaagagtt
agtagtgtgaagctaatttctaaagccaaaattagaactgttaaaatgacttttgttata
gttttggcttatatattgtgctggactccatttttctttgtacaaatgtggtctgtctgg
gacccaaaacctccaagagaagcatttgcttatgttattgctatgttgctggcaagtctg
aatagctgttgtaacccctggatctacatgttcttcaccggacacctctttcaggacctt
gttcaacgatttctttgctgctcagcccagtacttgaaatccaggcagcatggctgtgac
atcagcgtgagcagaaagagtaactcttcaacttttgctctgagcctcaaaagctcaagt
agtcagaaaagcatcacacagacatcgatgacacaaaactag

DBGET integrated database retrieval system