KEGG   Latimeria chalumnae (coelacanth): 102363528Help
Entry
102363528         CDS       T02913                                 

Definition
(RefSeq) glutathione S-transferase Mu 1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00480  Glutathione metabolism
lcm00980  Metabolism of xenobiotics by cytochrome P450
lcm00982  Drug metabolism - cytochrome P450
lcm00983  Drug metabolism - other enzymes
lcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102363528
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102363528
   00982 Drug metabolism - cytochrome P450
    102363528
   00983 Drug metabolism - other enzymes
    102363528
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lcm02000]
    102363528
Enzymes [BR:lcm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102363528
Transporters [BR:lcm02000]
 Other transporters
  Pores ion channels [TC:1]
   102363528
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_N GST_C GST_C_6 GST_C_2 GST_N_3 GST_N_2 AvrM_N
Motif
Other DBs
NCBI-GeneID: 102363528
NCBI-ProteinID: XP_006008525
Ensembl: ENSLACG00000005705
UniProt: H3A9V9
Position
Un
AA seq 220 aa AA seqDB search
MAMKLAYWDIRGLAQPIRLLLEYTGTPYEEKPYTCGEAPDYDKSCWFNEKYSLGLDFPNL
PYLCDGANKIVQSNAIMRYIARKHNLCGEKEQEIIRVDIMENQVMDFRNGFGMLCYNPKM
EDLKPAYMEKLPELLKQFSDFLGERPWFAGDKITFVDFLMYEMLDQHRMFEPKCLEKYKN
LQDFLDRFEALEKIAAYMKSSSFMKTPVNNKMAKWGAKKE
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggctatgaaacttgcttactgggatatcagggggttggcccagccaatccgtctgctg
ctagaatacactggcactccatatgaagagaagccctacacctgtggagaagcacccgac
tatgataaaagctgctggttcaatgaaaagtacagtctcggtctggatttccccaacctt
ccatatctctgtgatggggcgaacaagattgttcagagcaatgctatcatgagatacatt
gcacgaaagcacaacctgtgtggggagaaggaacaggagattatccgagtagacatcatg
gagaaccaagtgatggatttccgtaacggctttgggatgctgtgttataatcccaaaatg
gaagacctgaagcctgcatacatggagaagctgccagagctgctgaagcagttctcggac
tttcttggggagagaccatggtttgctggggataagatcacatttgtggatttcttgatg
tacgagatgttggaccagcatcgcatgtttgaacccaaatgcctggagaagtacaagaac
ctgcaggattttctggaccgctttgaggctttagaaaagattgcagcatacatgaagtcc
agttccttcatgaagaccccagttaacaataagatggccaagtggggagccaagaaagaa
taa

DBGET integrated database retrieval system