KEGG   Latimeria chalumnae (coelacanth): 102363934Help
Entry
102363934         CDS       T02913                                 

Gene name
GPX8
Definition
(RefSeq) glutathione peroxidase 8 (putative)
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00480  Glutathione metabolism
lcm00590  Arachidonic acid metabolism
lcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102363934 (GPX8)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102363934 (GPX8)
Enzymes [BR:lcm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     102363934 (GPX8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 102363934
NCBI-ProteinID: XP_005998510
Ensembl: ENSLACG00000012964
Position
Un
AA seq 211 aa AA seqDB search
MEPVTAYPLPLKCSLPKAKVFVVFLSMLFCTAVLFLLQMKLFKPKPGDFYSFQVKDLKGK
IVSLKKFRGKATLAVNVASSCAWTESNYRGLQELQREFGPSHFTVLAFPCNQFGDAEPGS
NKHIEAFAKGIYGVTFPIFSKIKILGSEAEPAFKFLIESSKKEPRGNFWKYLINPKGKVV
KYWRPEEPFENIKQDVADLVREIIIKKREEL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggagcctgtgactgcataccctctgcctttaaaatgctctcttcctaaagctaaggtg
tttgtggtttttctttccatgctgttctgcacggcagtgctgttcctgctacagatgaag
ctctttaaacccaaaccgggagatttttattctttccaagtgaaggatctgaaagggaag
atcgtttctctgaaaaagttcagaggcaaagcaaccctagctgtaaacgtggctagttcg
tgtgcctggactgagagcaactacaggggtttgcaggagttacagagagaatttggaccc
tcccacttcactgtgcttgccttcccttgcaaccagttcggagacgctgaacccggctcc
aacaaacacattgaggcctttgccaaaggaatctatggtgtcactttccccattttcagc
aagattaagattctgggctcagaagctgagcctgcttttaaatttcttatagagtcttca
aagaaagagcccaggggaaatttttggaaatatctcattaaccccaaggggaaagttgtc
aaatactggagaccggaagagccttttgagaacattaagcaagatgtggcagatttagtt
agagaaataattataaaaaagagagaagaactttga

DBGET integrated database retrieval system