KEGG   Latimeria chalumnae (coelacanth): 102364350Help
Entry
102364350         CDS       T02913                                 

Gene name
MTMR4
Definition
(RefSeq) myotubularin related protein 4
  KO
K18082  myotubularin-related protein 3/4 [EC:3.1.3.48 3.1.3.64 3.1.3.95]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00562  Inositol phosphate metabolism
lcm01100  Metabolic pathways
lcm04070  Phosphatidylinositol signaling system
lcm04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102364350 (MTMR4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    102364350 (MTMR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102364350 (MTMR4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lcm01009]
    102364350 (MTMR4)
Enzymes [BR:lcm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     102364350 (MTMR4)
    3.1.3.64  phosphatidylinositol-3-phosphatase
     102364350 (MTMR4)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     102364350 (MTMR4)
Protein phosphatases and associated proteins [BR:lcm01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    102364350 (MTMR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related FYVE Y_phosphatase Y_phosphatase3 DSPc
Motif
Other DBs
NCBI-GeneID: 102364350
NCBI-ProteinID: XP_005992302
Ensembl: ENSLACG00000014570
UniProt: H3B3R3
Position
Un
AA seq 1168 aa AA seqDB search
MGEEGPPSLEYIQAKDLFPQKELVKEEESLQVPFPVLQGEWVEYLGRTENAVISISNYRL
HVKLKDSVINTHQPGVDNEISVPLRLIESVESRDMFQLHIVCKDSKVVRSHFSTFKQCQE
WLKRLNRAVAHPARLEDLFAFAYHAWCLGVCADEEDQHVHLCRPGDHVRHRFEMELLRMG
FDLQNAWRVSEINKNYKLCSSYPQKLLVPVWITDKELENVGSFRSWKRIPVVVYRHQRNG
AVIARCSQPEISWWGWRNTDDEYLVTSIAKACALNPGTRAASGSNAKGKSEGSNTSDTDF
DSSLTACPSVENGGVPQKLLILDARSYTAAVANRAKGGGCECEEYYPNCEVMFMGMANIH
SIRNSFQSLRGVCSQIPDPGNWLSALENTKWLQHLSVMLKAATLVSNAVDREGRPVLVHC
SDGWDRTPQIVALAKILLDPYYRTIEGFQVLVESDWLDFGHKFGDRCGHQENSEDLNEQC
PVFVQWLDCVHQLLKQFPCLFEFNEAFLVKLVQHTYSCLYGTFLCNNPCEREARNTYKRT
CSVWSLLRTGNKNFQNFLYITGNETILHPVCHVRALQLWTAVYLPTSSPCTAAEDNMDLY
HPPSNEEEELDARSLDRLPKTRSMDNLISACETGVPFTRTSSDPNLNKHCQEGRTSLEPR
SGTGVAAGAEISEGPVSFSIEHNGVSGEEEEGNGSSSSPHPGVANQENATSDENSNSLKD
YHLNLEAPTSPGSSSGICNGFNAKRNPSESQKREMRTVGKGPEGQERTCESVNVAKLPLQ
KRALKNGHMGKSALEYSGSSPAVDLLIMERKTKGTIVCSKNQDPERNSSIMSRPRAGAEN
SDVGKALLDSAWRCKKQTSPSQFSDFSMLDTNWDSMQGMAESTPVGEMEQKRALQLGCCN
KRLNSKHFQLLRGLVNGQCPLKDSLKQSSHHYLSLSSVGSRIKDSRFPTLCQSKQLQLGR
QLGMISSSSSSSSSSPSPPGCLDDDGLPFPVDVIQQRLRQIEAGYKHEVEQLRRQVRELQ
VRLESRQCCAPPSEPEVDYEDDFTCLKESDDSDEESSLSVQSDDRLSETSWESVEKKDTE
VTRWVPDHMASHCFNCDSAFWFVKRRHHCRNCGNVFCAGCCFLKLPIPDQQLYDPVLVCN
SCYDQIQVCRARELMSQQLKKPIATASS
NT seq 3507 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaagaggggccgcccagtttggagtacatccaggctaaggatctgttccctcag
aaggaactggtgaaggaggaagagagtctgcaggtgccatttccagtgctccagggcgag
tgggtcgagtacttgggacgcaccgagaatgcggtcatttcaatttccaattatcgcctt
catgttaaattgaaggattccgttataaatactcatcaaccaggggtggacaatgaaata
tcagtgcctttgaggctgattgagagcgtggagagtcgggacatgttccagttgcacatc
gtctgcaaggattccaaagtggtcaggtcccatttttccaccttcaagcagtgtcaggaa
tggctgaaaaggctgaacagggcggtggctcacccagccaggttggaggacctgtttgca
ttcgcctaccatgcttggtgtctcggggtctgtgcagatgaagaagatcagcacgtgcac
ctctgccgtccaggcgatcacgtgcggcaccggtttgaaatggagttgctgaggatgggc
tttgacctgcagaacgcctggagggtgtctgaaatcaacaagaactacaagctgtgttcg
agctatccacagaagctgctggttcccgtatggattacagacaaagaactggagaatgtg
ggttcgttcaggtcctggaagagaatcccagtcgtcgtatacagacaccagcgtaacggc
gctgtgattgcccgctgcagccagccggagatcagctggtgggggtggcgaaacacggac
gatgagtacctagttacgtcgattgctaaagcctgtgcccttaaccccgggacaagagca
gcaagcggcagtaacgctaaagggaaaagtgagggctccaatacttccgacacagacttt
gactcctcgctgaccgcatgccccagtgtggagaacgggggagtccctcagaagctgcta
atcctggacgccaggtcttacactgctgctgtcgccaacagggctaaagggggaggctgt
gagtgtgaagagtattatccaaattgcgaggtgatgttcatgggaatggctaatatccat
tccatccggaacagcttccagtccctccgaggtgtatgcagtcagataccagaccccggc
aactggttgtctgccctggagaataccaagtggctacaacatctgtcggtgatgctgaag
gcggcgacgttggtatcaaatgctgtggacagggaaggacgcccggttctggttcactgc
tcagacggctgggatcgaaccccccagattgtagctctagcaaagatcctgttagatcct
tactacaggacaatagagggtttccaggtgctggtagaaagtgactggctggattttggt
cacaagtttggcgatcgctgtgggcaccaggagaactcggaggacctgaatgaacagtgc
ccagtcttcgttcagtggctggactgtgtccatcagctgctcaaacagttcccttgtcta
tttgagttcaacgaggccttcttggtgaagctggttcagcatacatactcctgtctctat
ggaacttttctctgcaacaatccctgtgagagagaggcacgcaacacctacaaacgcaca
tgctcagtctggtcactgctgaggacaggaaataaaaactttcagaacttcctgtatata
acaggaaatgagacgattctgcacccagtgtgtcacgttcgagctctccagctctggact
gctgtgtatcttcctacatcatctccctgtactgctgctgaggacaacatggacctgtac
caccctccgagtaacgaggaggaggaactcgatgccaggtccctggacaggttaccaaaa
actcgctcaatggacaatctaatctctgcctgtgagactggggtcccctttacacgtacc
tccagtgaccccaacctcaacaagcattgtcaagagggaagaacaagcctggaacccaga
tctggaactggagttgcagcgggggcagaaatctcagagggaccagtatccttctcaata
gaacataatggtgtttcaggagaggaagaggaggggaatggcagttcaagcagtcctcat
ccaggtgttgcaaaccaagaaaatgctacaagtgatgaaaactctaactccctgaaggat
tatcacctgaatttggaggcccctaccagtcctgggagctccagcgggatctgtaatggc
ttcaatgctaaacgtaatcccagtgaaagtcaaaagagagaaatgaggactgtagggaaa
ggcccagaagggcaggagaggacttgtgaaagtgttaatgttgcaaagttgcctttacaa
aagagggcactaaaaaatgggcacatggggaagagtgcgttagagtacagtggaagttct
ccagctgtggacttgctaattatggagcgcaaaaccaaagggacgattgtttgcagtaag
aaccaagaccctgagaggaacagcagcattatgagccgaccccgcgctggggcagagaat
tcagatgtggggaaagcgctgttggactcagcctggagatgtaaaaagcagacctctcca
agccagttcagtgatttttccatgttggatacaaattgggatagcatgcaggggatggcc
gagtcaacgcctgttggagagatggaacagaaaagggcccttcagctgggctgttgtaac
aagagactgaacagcaagcactttcagttgctgaggggtttggtgaatggacaatgtcct
ctaaaggatagccttaagcagtcaagccatcattatttaagcctaagctctgtaggatct
cgcattaaggactccaggtttcctactttatgtcagtcaaagcagttgcagttaggcaga
caactggggatgatttcctcctcttcttcttcctcctcctcttctccctctccacctggt
tgcctagatgacgacgggctcccgttccctgtggacgtgatccagcaacgtctacggcag
atcgaggcagggtacaagcacgaggtggagcagctgcgcaggcaggtacgggagctgcag
gtcaggctggagagcaggcagtgttgtgcccctccctcagaacccgaagtcgattacgag
gatgactttacatgtctaaaagaatctgatgacagcgatgaggagtcgtccctctctgtc
caaagtgatgatcggctttccgagaccagctgggagtctgttgagaagaaggacacagag
gtaacccgctgggttccagaccacatggcctcccactgcttcaactgcgactctgcattt
tggtttgtgaaacgtaggcaccactgcaggaactgcgggaacgtgttttgtgccggctgc
tgcttcctgaagctgcccatccctgatcagcaactttatgacccagtcctggtttgtaac
tcctgctacgatcagatccaggtgtgtcgtgccagagagctcatgagccagcagttgaag
aagcccattgccaccgcgtccagctga

DBGET integrated database retrieval system