KEGG   Latimeria chalumnae (coelacanth): 102365116
Entry
102365116         CDS       T02913                                 

Definition
(RefSeq) 11-cis retinol dehydrogenase-like
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102365116
Enzymes [BR:lcm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     102365116
SSDB
Motif
Pfam: adh_short adh_short_C2
Other DBs
NCBI-GeneID: 102365116
NCBI-ProteinID: XP_014341270
Position
Un
AA seq 253 aa
MWFYVATLLIIWAVGWFIRDHIAIGNPRNKYVFITGCDTGFGNLLAKRLDKRGFRVLAGC
FTQKGADDLQRGTSSMLKTILLDVTKSDSIVKAANWVRSEVGDKGLLNIPYFGKRFYLPP
MSYGKRDMFHFGVRVALIEPGFFKTAVTSLEPIEKDLNRLWNQLSSDVRESYGQHYFGKY
IKVQRFYMNHFCDTDLSKVTSCMEHALMAKYPRTRYSPGWDAKLLWIPLSYAPACVADML
LVLLLPKPARSSH
NT seq 762 nt   +upstreamnt  +downstreamnt
atgtggttctacgtggcaacccttctcatcatctgggctgtgggctggtttattagggat
cacatagccatcggcaatcccaggaacaagtatgtcttcatcacgggctgcgacacgggc
ttcggcaacctgctggccaagcggctggacaagcggggattccgcgtcctggcagggtgt
ttcacacagaagggagccgacgacctccagagaggcacatcctccatgcttaaaaccatt
ttgctagacgttacaaaaagcgacagcattgttaaggcggcaaactgggtgcgcagtgag
gtgggagataaagggttgctgaacatcccatattttgggaaaagattctatttgcccccc
atgtcctatggaaagagggacatgtttcatttcggagttcgggttgccctgatcgagcct
ggcttctttaagacggcagtgaccagccttgagccaattgagaaggacctgaacagactc
tggaaccagctgagctcagacgtacgggaaagctacgggcaacattactttggaaaatat
atcaaagttcagaggttctacatgaatcacttctgcgacacagacctatccaaagtgacc
agctgcatggagcacgctctgatggccaagtatccccggacgcgctacagccctggctgg
gatgccaagctcctctggataccgctctcgtacgcccccgcttgcgttgcagatatgctg
ctggtgctgctgctccccaagcctgcaaggagtagccactaa

DBGET integrated database retrieval system