KEGG   Latimeria chalumnae (coelacanth): 102366280Help
Entry
102366280         CDS       T02913                                 

Gene name
FASLG
Definition
(RefSeq) Fas ligand
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04010  MAPK signaling pathway
lcm04060  Cytokine-cytokine receptor interaction
lcm04068  FoxO signaling pathway
lcm04210  Apoptosis
lcm04217  Necroptosis
lcm05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102366280 (FASLG)
   04068 FoxO signaling pathway
    102366280 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102366280 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102366280 (FASLG)
   04217 Necroptosis
    102366280 (FASLG)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102366280 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lcm04147]
    102366280 (FASLG)
   04052 Cytokines and growth factors [BR:lcm04052]
    102366280 (FASLG)
   04090 CD molecules [BR:lcm04090]
    102366280 (FASLG)
Exosome [BR:lcm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102366280 (FASLG)
Cytokines and growth factors [BR:lcm04052]
 Cytokines
  Tumor necrosis fators
   102366280 (FASLG)
CD molecules [BR:lcm04090]
 Proteins
  102366280 (FASLG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 102366280
NCBI-ProteinID: XP_014345429
Ensembl: ENSLACG00000015347
Position
Un
AA seq 259 aa AA seqDB search
MQQNLNHIYPQMFYMDGGTENTPRPCIYSIPTAYSLPPPIVRRKKKTRDCSPVFNTSVFI
LVLLALAGVGVGIFFILKLQWELNQLKEVVPTATLMPAVEKHIGLPSVSEQKKEPKKAAH
LTGYAGKNVNTGSKTLMWEHVFGLAFTSGIEYKGGGLFINETGLYFIYSKVYFRAQDCKG
GHLSLSHIVFKRTPRYSRDITLMETKKLNFCSNTGMWTRSTYLGGIFNLTRMDSVYVNVS
DLSLVSSDETKTFFGLYKI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagaatctgaatcacatctacccacagatgttttatatggatggcgggacagag
aatactccacgtccatgcatctacagcattcccactgcttattccttgccaccaccaata
gtaaggaggaagaaaaaaacaagggactgttccccagttttcaacacctcagtcttcatc
ctagtcctgctggcactggcaggggtgggtgtgggtatctttttcattctcaaactacag
tgggaactcaaccagctaaaagaggtagtacccactgcaacactaatgccagctgtggag
aagcatataggacttccatctgtctcagaacagaagaaagagccaaaaaaagctgcacat
ctaaccggatatgcaggaaaaaatgtaaatactggatccaaaaccttaatgtgggaacat
gtttttggcctggcttttacttctggtattgagtacaaaggaggaggattgttcatcaat
gaaacgggtctgtactttatttattccaaagtctattttcgggcacaggactgtaagggg
ggacacctgtccttaagtcacatagttttcaaaagaactccacgttattcaagggatatc
actctgatggaaactaagaagctaaacttttgcagcaatactgggatgtggacaagaagc
acctaccttggaggcatcttcaatttgacaagaatggacagtgtatacgtcaacgtgtca
gatctgagcctagttagttctgatgagactaaaactttttttggcttgtataaaatttag

DBGET integrated database retrieval system