KEGG   Latimeria chalumnae (coelacanth): 102367079
Entry
102367079         CDS       T02913                                 

Gene name
TM7SF2
Definition
(RefSeq) transmembrane 7 superfamily member 2
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00100  Steroid biosynthesis
lcm01100  Metabolic pathways
Module
lcm_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    102367079 (TM7SF2)
Enzymes [BR:lcm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     102367079 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 PEMT ICMT PLAC8
Other DBs
NCBI-GeneID: 102367079
NCBI-ProteinID: XP_014350697
Position
Un
AA seq 282 aa
MADKLRTPRTTELEFGGTLGAIVLPFFLPATVLYLLLTCYTEDASIWNFSPPVPTLGTLW
NSNTLLLYLAWIGFQAVLYMLPVGKVVEGMVLRDETRLKYRINGNPIYDFFIGHELNPRI
GSFDLKYFCELRPGLIGWEAVLTTMDIVHDGFGFMLAFGDLTWVPFTYTLQASFLVNHPQ
ELSTVTAVGIVLINALGYFIFRSANSQKNTFRRDPNHPDVAGLETIPTATGKRLLVAGWW
GFVRHPNYLGDLIMALAWSLPCGEXLVLVFWWVVLGGRRSVW
NT seq 849 nt   +upstreamnt  +downstreamnt
atggcggacaaacttagaactccacggaccacagaactggagtttggaggaactctcggt
gccattgttctgcccttctttctgcctgccacggtcctctatctccttctaacatgttat
acagaggatgcaagcatctggaacttctcaccacctgtgccaacgctcggcacactctgg
aactccaacacccttcttctttacctggcctggattggatttcaggctgtgctttacatg
ctgccagttgggaaggtggtggaagggatggtcctcagagacgagaccaggctcaagtat
cgaattaatggaaacccaatctatgactttttcattggacatgagttgaatcctcggatt
ggaagcttcgatctgaagtacttctgtgagctgaggcctggactgattggttgggaagct
gtcttgaccacaatggatatagttcatgatgggtttggcttcatgttggcgttcggtgac
ctgacctgggtccctttcacctacaccctccaggcctcctttctagttaatcacccacag
gagctcagtactgtcactgcagttggtatcgtactaatcaacgctctgggctatttcatc
ttccgcagcgcaaactcccagaaaaacacatttcgcagggaccccaaccaccccgatgtg
gcagggttggaaaccatccccacagcaacaggaaaacgtctgctagtggcaggctggtgg
ggttttgttcgacaccccaactacctgggagacctcatcatggcgctggcctggtccctg
ccttgtggtgagtagttggttttggttttttggtgggtggttttgggggggaggaggagt
gtttggtaa

DBGET integrated database retrieval system