KEGG   Latimeria chalumnae (coelacanth): 102367175
Entry
102367175         CDS       T02913                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
lcm  Latimeria chalumnae (coelacanth)
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lcm03036]
    102367175 (ANKRD53)
Chromosome and associated proteins [BR:lcm03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    102367175 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank_4 Ank Ank_3
Other DBs
NCBI-GeneID: 102367175
NCBI-ProteinID: XP_014351593
Position
Un
AA seq 496 aa
MVKLESQGLMDPKPGDGSDSKLASSSQTNKKRTLLQVDIVDIDNDELMAATIGDVTWLHQ
SMKKAKSTTQRDRNGFTAIHLAAKHGRLECVKILVEEYNVSVDLTNSQGCRPLHLVFSKE
HKLRSFQCMTYLLMQGAKINVQNSDRQTPLHKAASEGLQDCVAALVEAGADVSIKDTSGH
TPIDLTKIWGHRKCCRYLSHIMWKQGKDEFVRETERLNEIKYTLFLGELDYNKRVKKDKA
FFNDIAFGDWIEAKHLPVRLKRTKGIQLKSLPSSKFARDSQIDYVNVRHRKVQRTGRKSA
QTNFHDGITSAQKTSRGFHSTAIAKAEVGDDEEACCYPLAYLVYQEEMAKIVRARVYTLG
DPWNFSTNLETPPVVNIYRPITVRLGVDPNMIKLHDFRSYLILFKNEEGFPVIETKLGGR
PWPIPNLPFEEIRKSLFPDSEPSRIKIPQEFKSHCVLDILRKRPPARKRKPFSEVVLHLR
EMIDQKLIDMCQFDKY
NT seq 1491 nt   +upstreamnt  +downstreamnt
atggttaaattagaaagtcagggtctgatggatcctaaaccaggagacggaagtgacagc
aaattggcaagtagctctcagacgaataagaagaggactctgctccaagtggacatagtg
gacatagacaatgatgagctgatggcagccactatcggagatgtgacatggcttcatcag
agcatgaagaaggcaaagtcaacaacccagagagacagaaatggcttcactgccattcac
ttggctgctaagcatgggaggctggagtgtgtgaaaatactggttgaagagtacaacgta
agtgttgacttgactaattctcaaggttgcagaccactccacttggtatttagcaaggag
cataagctcaggtccttccagtgtatgacctatctgttgatgcagggagctaagatcaat
gttcagaattctgatagacagactccacttcacaaggcagcaagtgaaggtctccaggac
tgtgtggctgcactggttgaagccggagcagatgtcagcattaaggacacaagtggacac
acacctattgacttaaccaaaatctggggccacaggaagtgttgcaggtacctatcacac
atcatgtggaagcaaggcaaagatgaatttgttcgtgaaacggagcgcctgaatgaaatt
aaatacacattattccttggtgaactggactataacaagagggtcaagaaagataaagct
ttcttcaatgacattgcattcggtgactggattgaggcaaagcacttgccagtgaggctg
aaaaggaccaagggtatccagttaaaaagccttcctagctccaagtttgcccgtgatagc
caaatagattatgtcaacgtcaggcacagaaaagttcagaggacaggaagaaaatctgct
caaacaaatttccatgatgggatcacaagtgcccagaagacatcacgtggatttcattcg
acggctattgcaaaagcagaagttggggacgatgaagaggcttgctgttacccacttgct
tatcttgtttatcaggaagaaatggctaagattgttagggcaagggtatatactctaggg
gatccatggaactttagcacaaatcttgaaaccccaccagtggtaaatatctacaggcct
atcacggtccgcctgggtgtagaccccaacatgatcaagcttcatgacttcaggtcctac
ttgatcctctttaagaatgaagagggctttcctgtgattgagacaaaacttggcggaaga
ccttggcccatccctaacttgccttttgaggagataaggaaaagcctgtttccagatagt
gagccctcacggataaaaattccacaagagtttaagtcccattgtgtcctggatattctg
agaaagcggccgccagccaggaagcggaagccattttccgaagtggtcttacacctgcgt
gaaatgatagatcagaagttgatagacatgtgccagtttgataaatattaa

DBGET integrated database retrieval system