KEGG   Latimeria chalumnae (coelacanth): 102367556Help
Entry
102367556         CDS       T02913                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00350  Tyrosine metabolism
lcm00360  Phenylalanine metabolism
lcm00380  Tryptophan metabolism
lcm01100  Metabolic pathways
Module
lcm_M00037  Melatonin biosynthesis, tryptophan => serotonin => melatonin
lcm_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    102367556
   00360 Phenylalanine metabolism
    102367556
   00380 Tryptophan metabolism
    102367556
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lcm04147]
    102367556
Enzymes [BR:lcm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     102367556
    4.1.1.105  L-tryptophan decarboxylase
     102367556
Exosome [BR:lcm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102367556
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 102367556
NCBI-ProteinID: XP_006012146
Ensembl: ENSLACG00000004956
Position
Un
AA seq 340 aa AA seqDB search
MDYTEFRQRGKEMVDYIAKYLENIDQRQVYPDVEPGYLQPLIPDSAPKEPESFDEVIKDI
ERVIMPGVAHWQSPYFHAYFPAGNSFPSILADMLSGAIACVGFSWASSPACTELEIVMLD
WLGKMINLPEQFLACSNRGGGGVIMGTACEATLMSLLAARTKVIRQRQAENPNLKEAEIM
GRLVAYTSDQAHCSVERAVLIGGVKVKMIPSDEKLAARGEALRKAVEEDKAAGLIPFYFC
ATLGTTASCAFDNLLELGPICNAENLWMHIDAAYAGSAFICPEFRYLLDGIEFADSFDFN
PHKWLLVNFDCSTMWVKKKGDLISAFQINPVYLQHDHQDS
NT seq 1021 nt NT seq  +upstreamnt  +downstreamnt
atggattacacagagtttagacaaagaggaaaggagatggtggactacattgctaaatat
cttgagaatatcgaccagagacaggtgtatcctgatgtggaacctggttacctgcagcct
ctcatcccagactcggcacctaaagaacctgaaagttttgatgaggtcatcaaggacatt
gaaagagtaataatgcctggggtggctcattggcaaagtccttatttccatgcctacttc
ccagctggaaattcttttccatccattctagctgatatgctgtcaggggccattgcgtgt
gttggattttcctgggcctcaagcccagcctgtacagagttggagatagtgatgctggat
tggttggggaagatgatcaacttaccagagcagtttttagcctgcagtaacagaggtggt
ggtggagtgattatgggcactgcttgtgaagccacactgatgtcccttctagctgccagg
acaaaggtaataagacagcgacaagcagagaaccctaatctgaaggaggcggagatcatg
ggcagactggtggcttatacctctgaccaggctcactgctccgtggaaagggcagtgctg
atcggaggagtgaaagtgaagatgatcccctcagatgagaagcttgctgctcgaggggag
gcactgagaaaagctgtggaggaggacaaagctgcaggcctcatccctttctatttttgc
gcaacgctaggaaccacggcgtcctgtgcatttgacaacttactggaactgggtcctatt
tgtaatgctgagaacctctggatgcacattgatgcagcctacgcggggagcgcttttatt
tgccctgagttcagatatcttctagatggaattgagtttgcggactcctttgactttaac
cctcataaatggcttttggtgaactttgactgttcaacaatgtgggttaagaaaaaagga
gaccttatcagtgcctttcaaataaaccctgtttaccttcagcatgaccatcaggattct
g

DBGET integrated database retrieval system