KEGG   Latimeria chalumnae (coelacanth): 106703836Help
Entry
106703836         CDS       T02913                                 

Definition
(RefSeq) histamine N-methyltransferase-like
  KO
K00546  histamine N-methyltransferase [EC:2.1.1.8]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00340  Histidine metabolism
lcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    106703836
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lcm04147]
    106703836
Enzymes [BR:lcm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.8  histamine N-methyltransferase
     106703836
Exosome [BR:lcm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106703836
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_12 PSY3 DUF2989 Methyltransf_31 NodS
Motif
Other DBs
NCBI-GeneID: 106703836
NCBI-ProteinID: XP_014344933
Ensembl: ENSLACG00000012024
Position
Un
AA seq 226 aa AA seqDB search
MDLQILGKLQALFPEVCINSEVVEPNEDHVSKYKALVAKSQSHKDVIFNWHQVTSTEYKN
QLKQENGERKFDFIHMIQMLYYVEDVAKTIRFFRNCLETNSTLLIVVVSGTSGWATLWKK
YSHRFPVSASRNYVTSFEIIEILQKLGAPYQSIDLKSNVDITECFLEGNENGELLVDFLA
HICNFNKTAPSDLQAEVLETLRTECSTEVDGKVFFDDTMGLLFVEP
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcagattcttgggaaattacaagctctctttccagaagtctgtattaacagt
gaagtcgtagagcctaatgaagaccatgtctccaagtacaaagctcttgttgccaagtcc
caaagccataaggatgtcatttttaactggcatcaggtaaccagcacagagtataaaaat
cagctcaaacaggaaaatggagagaggaaatttgacttcattcacatgatccagatgctg
tattatgtggaagatgttgccaagactatacgtttcttcagaaactgccttgaaacaaac
agcacactcttgattgttgtggtgtcaggtaccagtggatgggccacattgtggaagaaa
tacagccaccgctttccagtcagtgcttctcgcaactatgtcacctcctttgagatcata
gaaatcctccaaaaacttggcgcaccgtaccagagcattgatctgaagtcaaatgttgac
ataaccgaatgctttcttgagggtaatgagaacggggagctccttgtggattttctcgca
catatttgtaattttaataaaactgctccctccgatctccaggctgaagttctggagacg
cttcgcactgaatgtagtacagaagtggacggaaaggttttcttcgatgatacaatgggc
ttgctgtttgttgaaccatag

DBGET integrated database retrieval system