KEGG   Leuconostoc carnosum: C270_03575Help
Entry
C270_03575        CDS       T02321                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
lcn  Leuconostoc carnosum
Pathway
lcn00280  Valine, leucine and isoleucine degradation
lcn00650  Butanoate metabolism
lcn00900  Terpenoid backbone biosynthesis
lcn01100  Metabolic pathways
lcn01110  Biosynthesis of secondary metabolites
lcn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lcn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    C270_03575
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    C270_03575
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C270_03575
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    C270_03575
Enzymes [BR:lcn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     C270_03575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N Chal_sti_synt_N ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AFT81628
UniProt: K0D9W8
Position
746486..747646
Genome map
AA seq 386 aa AA seqDB search
MTIGIDKIAFYTPKYVLDLIELAKVRGDEPEKYTIGIGQDKQSVVPNYEDIVTMGANAAS
KIIDDTDRQLIDSVILATESGIDNSKSGAIYIQRLLNLSEFTRTIELKQACYAGTYGLMQ
ARDYVAAHPGRRVLVIASDIARYGLATPGEVTQGAGAIAMIISDNPKIASINTDSVYMSA
ERADFWRPLDRTQALVDGHLSTDIYKEMFLTLWQRYCTKTQQTISDFSGFAFHLPYTKMG
KKALDEVLDQATAEQQVNLMEKLKASQQLSRQVGNIYTGSVYLSLLSLLSYSDKLQSGEK
IAIFSYGSGAEAELYSITLQENFTEYVPRKSVKQLLEGRQKLSVSEYEAVFNSQLFDSHV
NVKSEAVSGVTQFQFLGWQNGERVYA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgacaattggtattgataaaatagcgttttatacaccaaaatatgtattggatttaatc
gaattggcaaaagtacgtggcgatgaacctgagaaatatactattggcattggtcaagat
aaacaatcagttgttccaaattatgaagatattgttactatgggggcaaatgcagcatcc
aaaattattgacgatactgatcgacaattaattgatagtgttattttagccacagaatca
ggtattgataattccaaatctggtgccatttatattcagaggcttttaaatttatcagaa
tttacacggacaattgaactcaagcaagcctgctatgcggggacttatggcttaatgcag
gcgcgtgactatgtggcggcacatccaggacgacgagttttagttattgcttcagatatt
gcgcgttacggtttagcgacaccaggtgaggtcacacaaggtgctggggctatcgcaatg
attatctcagataatccaaaaattgcatctataaacacagattcagtttatatgagtgct
gaacgtgctgatttttggcgacctttagatcggacgcaggcgctagttgatggacattta
tcaacagatatttacaaagaaatgtttctaacattatggcaacgctattgcaccaaaacg
caacaaacaatcagtgatttttctggttttgcttttcatttaccctatacaaagatgggg
aagaaggcgctggatgaggtgctagatcaagcaactgcagaacaacaagttaacttaatg
gaaaagttaaaagcgagtcaacaattgagccgtcaagtaggcaatatatatacaggatca
gtatatctcagtttattatcactgctgagttattcagataagttgcaatctggtgaaaaa
atagcaatttttagttatggatcaggtgcagaggctgaactgtattctatcactttacaa
gaaaattttactgaatatgtgccaagaaagtctgtcaaacaattacttgaaggtcgccaa
aaactatctgttagtgagtatgaagcagtgtttaattcacaattgtttgattcacatgtt
aatgttaaatcagaagctgtatctggtgtgacacaatttcaatttttgggatggcagaat
ggtgagcgtgtttatgcataa

DBGET integrated database retrieval system