KEGG   Leuconostoc carnosum: C270_03805Help
Entry
C270_03805        CDS       T02321                                 

Definition
(GenBank) threonine dehydrogenase related Zn-dependent dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
lcn  Leuconostoc carnosum
Pathway
lcn00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lcn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    C270_03805
Enzymes [BR:lcn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     C270_03805
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     C270_03805
    1.1.1.-  
     C270_03805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_N_assoc ADH_zinc_N_2 Glu_dehyd_C 2-Hacid_dh_C Pyr_redox_2 Pyr_redox TrkA_N PrmA PS-DH Pyr_redox_3 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AFT81672
UniProt: K0DDR0
Position
797097..798149
Genome map
AA seq 350 aa AA seqDB search
MKAAVWHGVKDVRVEDVELKPSKSNEVVVRVAYAGICGSDLHEYLEGPVFIPVDQPDELT
GGEAPLTMGHEFSGIIEKIGTDVTNFKVGDHVAINPTVTKGNLASDLDVYDGYSFIGLST
DGGFTSYVNVPEENLYHLPTEFSLELAATIEPTAVAVQAVKEGGLRFGEKVVIFGAGPIG
VLVAAAAKAAGATKIVAVDLSDVRLKKALEMGATDVVNPAEVSDTIAAISDIIPGGADVS
FEVAGVQPTFEQAIDATRPRGTVVIVSIFARPITFDPMKLMNAGVKLTTTIAYSKETFQQ
TVDLVSSEQINVKPVITDMIALENIVSNGFEALTQDKSQAKILIDLSKEQ
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctgtatggcatggtgttaaagatgttcgtgtggaagatgttgaattaaaa
ccatcaaagtcaaatgaagttgtggtgcgtgtagcatatgcaggcatctgcggtagtgac
ttacatgaatatcttgaaggaccagtttttattcctgttgatcagcctgatgaactaacc
ggtggagaagcaccactcacaatgggacacgagttttcaggtattattgaaaaaatcggt
acagatgttaccaattttaaagttggcgatcatgtagctattaacccaacggtgactaag
ggaaatttggccagtgatcttgatgtgtatgatggttatagcttcattggtttgagtacc
gatggtgggtttacatcatatgttaatgttcccgaagaaaatttgtaccatttaccaaca
gaattttctctggagctagctgcaactattgaaccaacagctgttgccgttcaagcggtt
aaagaaggtggtttacgttttggtgaaaaggtggttatttttggtgctggtccaattggt
gtattagttgccgctgctgccaaagcagctggtgctactaagattgtagcagttgatctg
tctgacgtacgcttaaagaaagcacttgaaatgggcgcaactgatgttgtgaaccctgcg
gaagtgtcggatactattgctgcaattagtgatattattcctggtggtgcagatgtatca
tttgaagtagctggcgtacaaccaacttttgagcaagccatagatgccacaagacctcgt
ggtactgttgtcattgtgtcaatatttgcacgtccgattacttttgatccaatgaaactg
atgaatgctggtgttaaattaacaacgactatcgcctattcgaaggaaactttccaacaa
acagttgatcttgtaagtagcgaacagattaatgtcaagccagttattactgacatgatt
gctcttgaaaacattgtttcaaatggatttgaagcactaacacaggataaatcacaagca
aaaatcttaatagatttaagtaaagaacaataa

DBGET integrated database retrieval system