KEGG   Leuconostoc carnosum: C270_05950Help
Entry
C270_05950        CDS       T02321                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lcn  Leuconostoc carnosum
Pathway
lcn00230  Purine metabolism
lcn01100  Metabolic pathways
Module
lcn_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lcn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    C270_05950 (gmk)
Enzymes [BR:lcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     C270_05950 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 Rad17 MMR_HSR1 AAA DUF5105 RsgA_GTPase cwf21 AAA_22 AAA_16
Motif
Other DBs
NCBI-ProteinID: AFT82099
UniProt: K0D840
Position
complement(1255678..1256274)
Genome map
AA seq 198 aa AA seqDB search
MTQRGLLIVLSGPSGVGKGTVRKAIFEEDGIDFQYSISATTRQPRTGEVDGEDYFFVSHD
EFESKIANGDMLEYAQYVNNYYGTPKSFIDDTLSSGRDVFLEIDVQGALQVKSKMPEGIY
IFLTPPDLTNLRERLVGRGTDSQEVIEKRVAAARDELKQMINYDYAVENDQVTNAVDRIK
SIIKSERLRVTRVFEKTF
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcgtggtttactaattgtattatctggcccttccggagttggaaaagggaca
gtgcgcaaggctatttttgaagaagatggcattgattttcaatattctatctcggcaaca
acccgccaaccaagaactggtgaagttgatggcgaagactatttttttgtttctcatgat
gaatttgaaagtaaaatagcgaatggtgatatgttagaatatgcacagtatgtcaacaat
tactatgggacacctaaaagttttatagatgatacactttcaagtggcagagatgtcttt
cttgaaattgatgtacaaggagctttgcaagtaaagtcaaaaatgccagaaggtatttac
atatttttgacaccaccagatttaacaaatttacgagaacgtctagtaggtcgtggtact
gactcacaagaagttatcgaaaaacgtgttgcagctgcacgtgatgaactgaaacaaatg
attaattatgattatgctgttgaaaatgaccaagttactaacgcagttgatcgtattaaa
tcaattatcaaatcagaacgtttgcgtgttacgcgcgtttttgaaaaaacattttag

DBGET integrated database retrieval system