KEGG   Leuconostoc carnosum: C270_06510Help
Entry
C270_06510        CDS       T02321                                 

Definition
(GenBank) methionyl-tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lcn  Leuconostoc carnosum
Pathway
lcn00450  Selenocompound metabolism
lcn00970  Aminoacyl-tRNA biosynthesis
lcn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    C270_06510
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    C270_06510
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lcn01007]
    C270_06510
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lcn03016]
    C270_06510
Enzymes [BR:lcn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     C270_06510
Amino acid related enzymes [BR:lcn01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   C270_06510
Transfer RNA biogenesis [BR:lcn03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    C270_06510
 Prokaryotic type
   Other AARSs
    C270_06510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f DUF2833
Motif
Other DBs
NCBI-ProteinID: AFT82211
UniProt: K0DDZ6
Position
complement(1368199..1370310)
Genome map
AA seq 703 aa AA seqDB search
MSEPNNVLFNTANLTDSAVIYDKFSKAEQQFATKKDKTFYITTPIYYPSGKLQLGNTYTT
VLADAAARYHRLLGEDVYFLTGTDEHGLKVQQKAKEIGKSEIEYLDGMAKQIKDLWQLMD
ISYNDFIRTTEERHESIVRKIFKHLVDNGDIYKGEYQGWYSVSDEEYFTESQLAEVYHDD
EGKVIGGKAPSGHEVELVKEESYFFKMSKYADWLLEYYKTHPEFIQPEARMNEMINNFIA
PGLEDLAVTRTSFDWGVSVPGDQKHVIYVWVDALVNYITALGYDTDHDELFKRYWPANVQ
LVGKEIVRFHTIYWPIILHALGLELPKTVLGHGWLVMKDGKMSKSKGNVIYPEVLEERYG
LDAVRYYLLRAMPFGNDGVFTPEDFVSRVNFDLANDLGNLLNRTVAMINKYENGIVPELN
TGKTEFDDDLVRTVSEGIADYHKNFQNMRTADALESVWTIIRRANKYIDETQPWVLAKDE
TKKAILSSVMAHLAASLRVVAVLLQPVLTKAPRKIYEQLGFDYPKNGAPIAGLSFGKLPT
GGKVVKKGQPIFPRQDVAEEVEFISGLVSKDTKGKGRAVKEAAKQAAVAADSGKSLIAYD
DFDKIELIAAKITAGEIVAKSDKLLKFTLDDGSGKPRQILSGIRQWYENPTVLVGKTVVI
VANMKPRKMAGEVSEGMILSAEKNGIVTVTTVPDSIEPGSGIE
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaccaaacaatgtcttgtttaatacagctaatcttacggattcagcagttatt
tatgataagttttcaaaagcagaacaacaatttgcaactaagaaagataaaactttctat
attacaacgcctatttattatccatctgggaaattacaattaggtaatacttatacgacg
gtgttggcagatgctgctgcgcggtatcatcgtttactaggggaagatgtttatttccta
acaggaacagatgagcatggtttgaaagtacagcaaaaagctaaagaaattggcaaatct
gaaattgaatatttagatggcatggctaaacaaattaaagatttgtggcagttaatggat
atttcttacaatgattttattcgaacaactgaggagcgtcacgaatcgattgttcgtaaa
atttttaagcacttagttgataatggtgatatttacaaaggtgagtatcaaggttggtat
tccgtttcagatgaagagtattttacagaatcacaacttgctgaggtttatcatgatgat
gaaggtaaagttatcggtggtaaggcaccatcaggtcatgaagtggaattggtcaaagaa
gaatcttatttctttaagatgagcaaatatgctgattggttgttggaatattataaaaca
catccagaatttatccaaccagaagctcgtatgaatgaaatgatcaataatttcattgca
ccaggcttagaagatttagcagtgacccgtacaagttttgactggggtgtgtccgttcct
ggggatcaaaagcatgttatatatgtttgggttgatgcgttggtcaactatattacagcg
cttgggtatgatactgatcatgatgaattgtttaaacgttattggccagccaatgtccaa
ttggtgggcaaagaaatcgttcgtttccatacaatttattggccaattattttgcatgcc
ctaggtctagagctaccaaagacagttcttggtcacggttggttagtgatgaaagacggt
aaaatgtcaaaatctaagggtaatgtcatttatcctgaagttttggaagagcggtatggc
ttagatgctgtccgttactatttattgcgtgctatgccatttggtaatgatggtgtcttt
acaccagaagattttgtttcacgggttaacttcgacttagcaaatgatcttggtaattta
ctaaatcgtaccgtagctatgattaacaagtatgaaaatggtattgtaccagaactaaat
actggtaaaactgaatttgatgatgatttggtgcgtactgtgtcagaaggcattgctgac
taccataagaactttcagaatatgcggacagctgatgcacttgagagtgtatggacaatt
attcgtcgtgcaaataaatatattgatgaaacgcagccttgggtattagctaaagatgaa
accaaaaaagcgattttgtctagcgtgatggcacatttagctgcttcattacgcgttgta
gctgtgttgttgcaacctgttctgaccaaagcgccacgcaaaatatacgaacaactagga
tttgattatcctaaaaatggtgcgccaattgctggtttgtcatttggtaaattaccaaca
ggtggtaaagtcgttaaaaaaggacagccaatttttcctcggcaagatgttgctgaagaa
gttgagtttatttctggattggtatcaaaagatactaaaggcaagggccgcgctgttaaa
gaagctgctaaacaagcagctgttgcagctgattctggtaagtcattaattgcttatgat
gattttgataaaattgaattaatagcggccaaaattaccgccggtgaaattgttgctaaa
tctgataagctgttgaaatttacacttgatgatggttcaggtaaaccacgccaaattctg
tcagggattcgtcaatggtatgaaaatccaactgtattagttggtaagacagttgtcatt
gttgccaatatgaagcctcgtaaaatggctggtgaagtatcagaaggcatgattttatca
gcagaaaagaacgggatagtcactgttacaacagtaccagatagtattgaacctggttca
ggaatagaataa

DBGET integrated database retrieval system